SAB2105340

Anti-JARID2 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-AI317256, Anti-AU045941, Anti-C79929, Anti-C79931, Anti-Jmj
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 137 kDa
• reactividad de especies: human, mouse
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NM_021878
• Nº de acceso UniProt: Q62315
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... JARID2(3720) ; mouse ... Jarid2(16468)

Descripción

Inmunógeno

Synthetic peptide directed towards the middle region of mouse Jarid2

Acciones bioquímicas o fisiológicas

Jarid2 is a regulator of histone methyltransferase complexes that plays an essential role in embryonic development, including heart and liver development, neural tube fusion process and hematopoiesis.Jarid2 acts by modulating histone methyltransferase activity and promoting the recruitment of histone methyltransferase complexes to their target genes.Jarid2 binds DNA and mediates the recruitment of the PRC2 complex to target genes in embryonic stem cells.Jarid2 does not have histone demethylase activity but regulates activity of various histone methyltransferase complexes. In embryonic stem cells, it associates with the PRC2 complex and inhibits trimethylation of ′Lys-27′ of histone H3 (H3K27me3) by the PRC2 complex, thereby playing a key role in differentiation of embryonic stem cells and normal development. In cardiac cells, it is required to repress expression of cyclin-D1 (CCND1) by activating methylation of ′Lys-9′ of histone H3 (H3K9me) by the GLP1/EHMT1 and G9a/EHMT2 histone methyltransferases.Jarid2 also acts as a transcriptional repressor of ANF via its interaction with GATA4 and NKX2-5.Jarid2 participates in the negative regulation of cell proliferation signaling.

Secuencia

Synthetic peptide located within the following region: NASSSCQSTPRKGKTHKHVHNGHVFNGSSRSAREKEPAHKHRSKEATPGK

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable