SAB2102232

Anti-SMAD4 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-DPC4, Anti-JIP, Anti-MADH4, Anti-SMAD family member 4
• MDL number: MFCD01634190
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• antibody form: affinity isolated antibody
• Quality Level: 100
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 60 kDa
• species reactivity: horse, bovine, sheep, guinea pig, dog, mouse, human, rat, rabbit, goat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• UniProt accession no.: Q13485
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SMAD4(4089)

Descripción

Immunogen

Synthetic peptide directed towards the N terminal region of human SMAD4

Biochem/physiol Actions

SMAD4 is one of the Smad family members, which are essential intracellular signalling components of the transforming growth factor-beta (TGF-beta) superfamily. Smad2 and Smad3 are structurally highly similar and mediate TGF-beta signals. Smad4 is distantl

Sequence

Synthetic peptide located within the following region: MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable