SAB2100053

Anti-ADARB2 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-ADAR3, Anti-Adenosine deaminase, RNA-specific, B2 (RED2 homolog rat), Anti-FLJ25034, Anti-FLJ36975, Anti-HRED2, Anti-RED2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 80 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso UniProt: Q9NS39
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ADARB2(105)

Descripción

Inmunógeno

Synthetic peptide directed towards the middle region of human ADARB2

Acciones bioquímicas o fisiológicas

ADARB2 is a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing. This gene encodes a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-48 DA533361.1 1-48 49-369 AF034837.1 9-329 370-474 AI695657.1 188-292 c 475-2821 AF034837.1 435-2781 2822-3521 AL392083.17 12183-12882 c 3522-3668 BC047443.1 1389-1535

Secuencia

Synthetic peptide located within the following region: SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable