Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

SAB1411909

Sigma-Aldrich

ANTI-IL11 antibody produced in mouse

clone 3C6, purified immunoglobulin, buffered aqueous solution

Sinónimos:

AGIF, IL-11, IL11

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3C6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable

isotype

IgG2bκ

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... IL11(3589)

Categorías relacionadas

General description

The interleukin 11 (IL11) gene, with five exons spanning 7kb of genomic DNA, is mapped to human chromosome 19q13.42. The encoded protein belongs to the IL-6 family of cytokines. IL-11 is secreted by activated astrocytes.
The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. (provided by RefSeq)

Immunogen

IL11 (NP_000632, 23 a.a.-199 a.a.) partial recombinant protein.

Sequence
GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Biochem/physiol Actions

Interleukin 11 (IL11) stimulates tumorigenesis in conjunction with angiogenesis of the primary tumor and of metastatic progenies at distant organs. IL-11 signaling is considered as a rate-limiting step for the tumorigenesis in the mucosa of the gastrointestinal tract. Thus, inhibition of IL-11 signaling can be considered as an emerging therapeutic strategy for various cancers. In addition, this protein also performs a protective role by increasing platelet recovery and inflammatory responses, in sepsis patients with thrombocytopenia. Mutation in the gene increases the risk of susceptibility to Hirschsprung disease and multiple sclerosis (MS).

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Cameron N Johnstone et al.
Cytokine & growth factor reviews, 26(5), 489-498 (2015-07-27)
Interleukin (IL)-11 is a member of the IL-6 family of cytokines that is defined by the shared use of the GP130 signal transducing receptor subunit. In addition of its long recognized activities as a hemopoietic growth factor, IL-11 has an
D McKinley et al.
Genomics, 13(3), 814-819 (1992-07-01)
The genomic sequence of human interleukin-11 (IL11) has been isolated based on its sequence homology with a cDNA clone encoding primate IL11. The human IL11 genomic sequence is 7 kb in length and consists of five exons and four introns.
Bing Wan et al.
Cytokine, 76(2), 138-143 (2015-08-16)
To examine the platelet recovering and anti-inflammatory effects of IL-11 in the treatment of sepsis, accompanied with thrombocytopenia and to investigate the associated mechanisms via a case-control study. 105 patients enrolled for the study were segregated into (1) IL-11 therapy
L H Kim et al.
Neurogastroenterology and motility : the official journal of the European Gastrointestinal Motility Society, 27(10), 1371-1377 (2015-07-15)
Hirschsprung disease (HSCR) is a congenital and heterogeneous disorder characterized by the absence of enteric ganglia during enteric nervous system (ENS) development. Our recent genome-wide association study has identified a variant (rs6509940) of interleukin-11 (IL-11) as a potential susceptible locus
IL-11 in multiple sclerosis.
Xin Zhang et al.
Oncotarget, 6(32), 32297-32298 (2015-10-10)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico