Saltar al contenido
Merck
Todas las fotos(6)

Documentos clave

HPA038002

Sigma-Aldrich

Anti-METTL14 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-KIAA1627, Anti-Methyltransferase like 14

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41
En este momento no podemos mostrarle ni los precios ni la disponibilidad

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500

secuencia del inmunógeno

RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... METTL14(57721)

Descripción general

The gene METTL14 (methyltransferase like 14) is mapped to human chromosome 4q. It is a homologue of METTL3.[1] The protein has an N-terminal α-helical motif (NHM), methyltransferase domain and a C-terminal motif.

Inmunógeno

methyltransferase like 14 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-METTL14 antibody produced in rabbit has been used in western blotting and immunofluorescence.[2]
Anti-METTL14 antibody produced in rabbit has been used in:
  • cross-linking and RNA immunoprecipitation (CLIP)
  • western blot
  • immunohistochemical analysis

Acciones bioquímicas o fisiológicas

METTL14 (methyltransferase like 14) is mainly responsible for m6A (N6-methyladenosine) RNA methylation. It forms a heterodimer with METTL3 and the complex catalyzes m6A RNA methylation.[1]
METTL14 mutation reduces m6A methylation in ~70% of endometrial tumors.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST79779

Forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

N6-methyladenosine alters RNA structure to regulate binding of a low-complexity protein
Liu N, et al.
Nucleic Acids Research, 45(10), 6051-6063 (2017)
Region-specific RNA m6A methylation represents a new layer of control in the gene regulatory network in the mouse brain
Chang M, et al.
Open Biology, 7(9), 170166-170166 (2017)
The m(6)A Methyltransferase METTL3 Promotes Translation in Human Cancer Cells.
Lin S, et al.
Molecular Cell, 62, 335-335 (2016)
Array comparative genomic hybridization analysis identified the chromosomal aberrations and putative genes involved in prostate tumorigenesis of Malaysian men.
Saaid NN, et al.
Sains Malaysiana, 43, 1317-1326 (2014)
METTL14 inhibits hematopoietic stem/progenitor differentiation and promotes leukemogenesis via mRNA m6A modification
Weng H, et al.
Cell Stem Cell, 22(2), 191-205 (2018)

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico