Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

HPA034982

Sigma-Aldrich

Anti-ABCB7 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-ABC7, Anti-ASAT, Anti-ATP-binding cassette, sub-family B (MDR/TAP), member 7, Anti-Atm1p, Anti-EST140535

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

GAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQEEI

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ABCB7(22)

General description

ATP binding cassette subfamily B member 7 transporter protein (ABCB7) is located in mitochondrial inner membrane and encoded by ABACB7 gene on human chromosome Xq13.3. It has ATP binding cassette domain and belongs to the multidrug resistance/ transporter antigenic peptides MDR/TAP subfamily.

Immunogen

ATP-binding cassette, sub-family B (MDR/TAP), member 7 recombinant protein epitope signature tag (PrEST)

Application

Anti-ABCB7 antibody produced in rabbit has been used for the detection of ABCB7 protein in immunoblotting.

Biochem/physiol Actions

ATP binding cassette subfamily B member 7 transporter protein (ABCB7) is involved in the transport of heme from the mitochondria to the cytosol. It is also involved in heme biosynthesis and homeostasis. Silencing of ABCB7 RNA and mutations in ABCB7 is implicated in sideroblastic anemia with ataxia. Alternate splicing of ABC7 gene results in premature protein termination and is associated with myelodysplastic syndromes.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST78281

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Human ABC7 transporter: gene structure and mutation causing X-linked sideroblastic anemia with ataxia with disruption of cytosolic iron-sulfur protein maturation
Bekri S, et al.
Blood, 96(9), 3256-3264 (2000)
RNA silencing of the mitochondrial ABCB7 transporter in HeLa cells causes an iron-deficient phenotype with mitochondrial iron overload
Cavadini P, et al.
Blood, 109(8), 3552-3559 (2007)
The ABC transporter Atm1p is required for mitochondrial iron homeostasis
Kispal G, et al.
Febs Letters, 418(3), 346-350 (1997)
Cryptic splicing events in the iron transporter ABCB7 and other key target genes in SF3B1-mutant myelodysplastic syndromes
Dolatshad H, et al.
Leukemia, 30(12), 2322-2322 (2016)
The L-cysteine desulfurase NFS1 is localized in the cytosol where it provides the sulfur for molybdenum cofactor biosynthesis in humans
Marelja Z, et al.
PLoS ONE, 8(4), e60869-e60869 (2013)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico