HPA018254

Anti-SPATA3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-Spermatogenesis-associated protein 3, Anti-Testis and spermatogenesis cell-related protein 1, Anti-Testis spermatocyte apoptosis- related protein 1
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA018254
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• enhanced validation: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• technique(s): immunohistochemistry: 1:50- 1:200
• immunogen sequence: MKKVKKKRSEARRHRDSTSQHASSNSTSQQPSPESTPQQPSPESTPQHSSLETTSRQPAFQALPAPEIRRSSCCLLSPDAN
• UniProt accession no.: Q8NHX4
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SPATA3(130560)

Descripción

General description

The gene SPATA3 (spermatogenesis-associated protein 3) has been mapped to human chromosome 2q37. The gene encodes a testis-specific protein. In rat model, SPATA3 is identified as a new member of HSP40 (Heat shock protein 40) protein family since the sequence contains the highly conserved J domain. The protein is localized in the cytoplasm.

Immunogen

Spermatogenesis-associated protein 3 recombinant protein epitope signature tag (PrEST)

Application

Anti-SPATA3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Spermatogenesis-associated protein 3 (SPATA3) may play role in spermatogenesis cell apoptosis. In mouse model, SPATA3 is down-regulated in male germ cells post X-ray irradiation.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74241

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)