HPA003230

Anti-PDIA3 antibody produced in rabbit

Ab2, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-58 kDa glucose-regulated protein antibody produced in rabbit, Anti-58 kDa microsomal protein antibody produced in rabbit, Anti-Disulfide isomerase ER-60 antibody produced in rabbit, Anti-ERp57 antibody produced in rabbit, Anti-ERp60 antibody produced in rabbit, Anti-Protein disulfide-isomerase A3 precursor antibody produced in rabbit, Anti-p58 antibody produced in rabbit
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA003230
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulario: buffered aqueous glycerol solution
• reactividad de especies: mouse, rat, human
• validación mejorada: RNAi knockdown; orthogonal RNAseq; independent; Learn more about Antibody Enhanced Validation
• técnicas: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:2500-1:5000
• secuencia del inmunógeno: PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
• Nº de acceso UniProt: P30101
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... PDIA3(2923)

Descripción

Descripción general

PDIA3 (protein disulfide isomerase family A, member 3) is a multi-functional protein, which belongs to the protein-disulfide isomerase family. It is thought to be a membrane receptor for 1,25-dihydroxyvitamin D3 (1α,25(OH)2D3), and is localized to endoplasmic reticulum, nucleus, plasma membrane and extracellular matrix.

Inmunógeno

Protein disulfide-isomerase A3 precursor recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-PDIA3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)

Acciones bioquímicas o fisiológicas

PDIA3 (protein disulfide isomerase family A, member 3) is believed to be a membrane receptor for 1,25(OH)₂D₃ that stimulates rapid membrane responses through the vitamin D receptor. In the presence of Pdia3, 1,25(OH)₂D₃ stimulates prostaglandin E2, protein kinase C and other membrane signaling pathways during osteoblast maturation. It stimulates cellular response to chemotherapy-induced DNA damage. The protein functions as a disulfide isomerase protein that associates with lectin chaperones calreticulin and calnexin to mediate folding of glycoproteins. It is found to be secreted in the early stages of renal fibrosis.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST86567

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)