AV42559

Anti-ANKRD2 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-ARPP, Anti-Ankyrin repeat domain 2 (stretch responsive muscle), Anti-MGC104314
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 49 kDa
• reactividad de especies: guinea pig, horse, mouse, rabbit, human, dog, bovine, rat
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_001123453
• Nº de acceso UniProt: Q3B778
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ANKRD2(26287)

Descripción

Descripción general

Ankyrin repeat domain 2 (stretch responsive muscle) (Ankrd2), a MARP mechanosensing protein, is believed to be involved in skeletal muscle hypertrophy through the regulation of cell signaling and gene expression within muscle cells.

Especificidad

Anti-ANKRD2 antibody reacts with canine, human, mouse, and rat ankyrin repeat domain 2 (stretch responsive muscle) proteins.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ANKRD2

Aplicación

Anti-ANKRD2 polyclonal antibody is used to tag Ankyrin repeat domain 2 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role Ankrd2 in muscle cell development.

Acciones bioquímicas o fisiológicas

ANKRD2 may play an important role in skeletal muscle hypertrophy.

Secuencia

Synthetic peptide located within the following region: QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable