AV41491

Anti-GPX3 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-GPx-P, Anti-GSHPx-3, Anti-GSHPx-P, Anti-Glutathione Peroxidase 3 (plasma)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 25 kDa
• reactividad de especies: mouse, rat, human, bovine
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_002075
• Nº de acceso UniProt: P22352
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... GPX3(2878)

Descripción

Descripción general

Glutathione peroxidase refers to a family of isozymes that protect organisms from oxidative damage by reducing lipid hydroperoxides to their corresponding alcohols. Glutathione peroxidase 3 (GPX3) is an extracellular Gpx isozyme found mainly in plasma.

Especificidad

Anti-GPX3 polyclonal antibody reacts with human, mouse, rat, bovine, canine, and pig glutathione peroxidase 3 proteins.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human GPX3

Aplicación

Anti-GPX3 polyclonal antibody is used to tag glutathione peroxidase-3 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to study the antioxidant lipid protecting role of glutathione peroxidase 3 in extracellular space and plasma.

Acciones bioquímicas o fisiológicas

GPX3 belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme. GPX3 expression appears to be tissue-specific.

Secuencia

Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable