Skip to Content
Merck
All Photos(7)

Key Documents

HPA014670

Sigma-Aldrich

Anti-ZDHHC5 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-DHHC-5, Anti-Palmitoyltransferase ZDHHC5, probable, Anti-Zinc finger DHHC domain-containing protein 5, Anti-Zinc finger protein 375

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

DPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHREPSPVRYDNLSRHIVASLQEREKLLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLGKTPLGRPAVPRFGKPDGLRGRGVGSPE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ZDHHC5(25921)

General description

ZDHHC5 (zinc finger, DHHC-type containing 5) is a member of the family of integral membrane proteins called DHHC (Asp-His-His-Cys). This family has its palmitoyl acyltransferases (PAT) activity conserved through Saccharomyces cerevisiae to mammals. This family has 23 identified members in humans, out of which 17 exhibit PAT activity. ZDHHC5 protein and the mRNA are highly expressed in neurons. It is found in dendrites, in dendritic shafts, and rarely in dendritic spine. ZDHHC5 gene is localized to human chromosome 11. It has the characteristic DHHC domain, and has a highly elongated C-terminal. This C-terminal contains PDZ-binding domain, which is specific for type II PDZ-ligand

Immunogen

Palmitoyltransferase ZDHHC5, probable recombinant protein epitope signature tag (PrEST)

Application

Anti-ZDHHC5 antibody produced in rabbit has been used in:
  • microarray
  • immunofluorescence
  • immunoprecipitation
  • coimmunoprecipitation

Anti-ZDHHC5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

ZDHHC5 (zinc finger, DHHC-type containing 5) is a palmitoyl acyltransferase (PAT), which has its three cysteine residues S-acylated, within the CCX7-13C(S/T) motif. It is responsible for the palmitoylation of somatostatin receptor subtype 5 (SSTR5), which is a GPCR (G-protein coupled receptor). It might also be involved in the palmitoylation of other GPCRs, especially in the brain. This might explain its role in learning, memory and synaptic function. Also this protein is highly expressed in neurons, and might have an essential regulatory role in the neurons. Suppression of ZDHHC5 in mice, shows reduced learning capabilities, and this protein is also linked with neuropsychiatric disorders. This gene locus is also associated with bipolar disorder. It also palmitoylates GRIP1 (Glutamate receptor-interacting protein 1)b protein, and targets it to the endosomes of dendritic cells. This way it controls the trafficking of AMPA-R (α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72922

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A ZDHHC5-GOLGA7 Protein Acyltransferase Complex Promotes Nonapoptotic Cell Death
Ko PJ, et al.
Cell Chemical Biology (2019)
Yusuke Ohno et al.
Molecular biology of the cell, 23(23), 4543-4551 (2012-10-05)
Palmitoylation plays important roles in the regulation of protein localization, stability, and activity. The protein acyltransferases (PATs) have a common DHHC Cys-rich domain. Twenty-three DHHC proteins have been identified in humans. However, it is unclear whether all of these DHHC
Systematic siRNA screen unmasks NSCLC growth dependence by palmitoyltransferase DHHC5
Tian H, et al.
Molecular Cancer Research, 13(4), 784-794 (2015)
Tarja Kokkola et al.
FEBS letters, 585(17), 2665-2670 (2011-08-09)
Many G-protein coupled receptors are palmitoylated in their C-terminal, intracellular regions. So far no enzymes responsible for this modification have been described. We identified an interaction of the membrane proximal helix 8 of somatostatin receptor 5 (SSTR5) with the N-terminal
Yi Li et al.
The Journal of biological chemistry, 287(1), 523-530 (2011-11-15)
Post-translational palmitoylation of intracellular proteins is mediated by protein palmitoyltransferases belonging to the DHHC family, which share a common catalytic Asp-His-His-Cys (DHHC) motif. Several members have been implicated in neuronal development, neurotransmission, and synaptic plasticity. We previously observed that mice

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service