Cdx2 is a homeobox gene that regulates trophectoderm differentiation and cell fate decisions in mouse blastocysts. CDX2 expression has also been linked to intestinal metaplasia and gastric carcinogenesis. Rabbit Anti-CDX2 antibody recognizes canine, chicken, human, mouse, rat, and pig CDX2.
Immunogen
Synthetic peptide directed towards the middle region of human CDX2
Application
Rabbit Anti-CDX2 antibody can be used for western blot assays at a concentration of 0.5μg/ml.
Biochem/physiol Actions
CDX2 encodes a protein that plays an important role in gallbladder carcinogenesis with intestinal differentiation. Cdx2 is a highly sensitive marker for Barrett′s esophagus.
Sequence
Synthetic peptide located within the following region: QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRY
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Development (Cambridge, England), 132(9), 2093-2102 (2005-03-25)
Blastocyst formation marks the segregation of the first two cell lineages in the mammalian preimplantation embryo: the inner cell mass (ICM) that will form the embryo proper and the trophectoderm (TE) that gives rise to the trophoblast lineage. Commitment to
The roles of CDX2 and CDX1 homeobox genes during gastric carcinogenesis remain poorly defined. We have studied the expression of CDX2/1 in gastric cancers and intestinal metaplasia (IM) of 69 gastric carcinoma patients by immunohistochemistry. CDX2/1 were shown to be
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.