Skip to Content
Merck
All Photos(3)

Key Documents

SAB2104768

Sigma-Aldrich

Anti-MYH-1 Antibody

rabbit polyclonal

Synonym(s):

Anti-MGC133384, Anti-MYHSA1, Anti-MYHa, Anti-MyHC-2X/D

Sign Into View Organizational & Contract Pricing
All Photos(3)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

product name

Anti-MYH1, (N-terminal) antibody produced in rabbit, affinity isolated antibody

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

223 kDa

species reactivity

bovine, mouse, rat, horse, human, rabbit, sheep, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

NM_005963

UniProt accession no.

P12882

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MYH1(4619)

Related Categories

Immunogen

Synthetic peptide directed towards the N terminal region of human MYH1

Biochem/physiol Actions

Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. Myosin hea

Sequence

Synthetic peptide located within the following region: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

recommended

Product No.
Description
Pricing

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Tue L Nielsen et al.
Biomedicines, 10(2) (2022-02-26)
Muscular dystrophies constitute a broad group of genetic disorders leading to muscle wasting. We have previously demonstrated that treating a muscular atrophy mouse model with growth factors resulted in increased muscle mass. In the present study, we treated the Duchenne
Guoliang Zhang et al.
Aging, 11(19), 8313-8328 (2019-10-03)
In this study, we used high-throughput RNA sequencing to identify mRNAs, long non-coding RNAs (lncRNAs) and circular RNAs (circRNAs) that are differentially expressed in the Substantia Nigra (SN) of aged and young rats. Gene Ontology and Kyoto Encyclopedia of Genes
Thomas O Krag et al.
Journal of neuropathology and experimental neurology, 75(5), 441-454 (2016-04-01)
McArdle disease (muscle glycogenosis type V) is caused by myophosphorylase deficiency, which leads to impaired glycogen breakdown. We investigated how myophosphorylase deficiency affects muscle physiology, morphology, and glucose metabolism in 20-week-old McArdle mice and compared the findings to those in
Shirley Nieves-Rodriguez et al.
Frontiers in genetics, 14, 1216066-1216066 (2023-08-14)
Muscle damage and fibro-fatty replacement of skeletal muscles is a main pathologic feature of Duchenne muscular dystrophy (DMD) with more proximal muscles affected earlier and more distal affected later in the disease course, suggesting that different skeletal muscle groups possess
Charles A Stuart et al.
American journal of physiology. Cell physiology, 310(5), C381-C389 (2015-12-18)
Muscle fiber composition correlates with insulin resistance, and exercise training can increase slow-twitch (type I) fibers and, thereby, mitigate diabetes risk. Human skeletal muscle is made up of three distinct fiber types, but muscle contains many more isoforms of myosin

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service