Skip to Content
Merck
All Photos(1)

Key Documents

HPA011101

Sigma-Aldrich

Anti-SPINT2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-HAI-2 antibody produced in rabbit, Anti-Hepatocyte growth factor activator inhibitor type 2 antibody produced in rabbit, Anti-Kunitz-type protease inhibitor 2 precursor antibody produced in rabbit, Anti-Placental bikunin antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:200- 1:500

immunogen sequence

CLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SPINT2(10653)

General description

SPINT2 (serine peptidase inhibitor, Kunitz type, 2) is a transmembrane Kunitz-type serine protease inhibitor, which contains two Kunitz-type domains. This protein is also called hepatocyte growth factor activator (HGFA) inhibitor 2 (HAI-2). It has a wide range of tissue expression, with predominant expression in kidney, prostate and placenta. It is also expressed in the non-epithelial cells in brain and lymph nodes.

Immunogen

Kunitz-type protease inhibitor 2 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

SPINT2 (serine peptidase inhibitor, Kunitz type, 2) is responsible for suppressing the enzyme hepatocyte growth factor activator (HGFA), which converts hepatocyte growth factor (HGF) in its active form. It might play a role in homeostasis of ions in intestine, and mutations in this gene are linked to syndromic congenital sodium diarrhea. It is up-regulated in cholangiopathies, and impacts fibrosis and differentiation of liver. In mice, it plays an essential role in the survival of embryo, placental development and neural tube closure. It inhibits a variety of serine proteases such as, pancreatic trypsin, plasmin, kallikrein. It is a putative tumor suppressor gene, and is down-regulated in certain solid cancers. It is under-expressed in Myelodysplastic syndromes (MDS), and alters the adhesion of mesenchymal stromal cells (MSCs) to pluripotent stem cells or leukemia cells. This leads to the maintenance of abnormal survival, proliferation and self-renewal of pluripotent stem cells, contributing to the pathophysiology of MDS.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72190

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Fernanda Marconi Roversi et al.
Stem cells and development, 23(10), 1109-1120 (2014-01-15)
Myelodysplastic syndromes (MDS) are clonal disorders involving hematopoietic stem cells (HSC) characterized by ineffective hematopoiesis. In addition to HSC defects, a defective hematopoiesis supporting capacity of mesenchymal stromal cells (MSCs) in the microenvironment niche has been implicated in MDS pathophysiology.
Márcia Santos Pereira et al.
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society, 64(1), 32-41 (2015-10-08)
SPINT2 is a tumor suppressor gene that inhibits proteases implicated in cancer progression, like HGFA, hepsin and matriptase. Loss of SPINT2 expression in tumors has been associated with gene promoter hypermethylation; however, little is known about the mechanisms of SPINT2
Stine Friis et al.
The Journal of biological chemistry, 289(32), 22319-22332 (2014-06-26)
The membrane-anchored serine proteases, matriptase and prostasin, and the membrane-anchored serine protease inhibitors, hepatocyte growth factor activator inhibitor (HAI)-1 and HAI-2, are critical effectors of epithelial development and postnatal epithelial homeostasis. Matriptase and prostasin form a reciprocal zymogen activation complex
C-H Tsai et al.
Oncogene, 33(38), 4643-4652 (2013-10-15)
Dysregulation of cell surface proteolysis has been strongly implicated in tumorigenicity and metastasis. In this study, we delineated the role of hepatocyte growth factor activator inhibitor-2 (HAI-2) in prostate cancer (PCa) cell migration, invasion, tumorigenicity and metastasis using a human
Peter Heinz-Erian et al.
American journal of human genetics, 84(2), 188-196 (2009-02-03)
Autosomal-recessive congenital sodium diarrhea (CSD) is characterized by perinatal onset of a persistent watery diarrhea with nonproportionally high fecal sodium excretion. Defective jejunal brush-border Na(+)/H(+) exchange has been reported in three sporadic patients, but the molecular basis of the disease

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service