WH0004282M1

Monoclonal Anti-MIF antibody produced in mouse

clone 2A10-4D3, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-GIF, Anti-GLIF, Anti-MMIF, Anti-macrophage migration inhibitory factor (glycosylation-inhibiting factor)
• MDL number: MFCD00211612
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2A10-4D3, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: BC000447
• UniProt accession no.: P14174
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: glycosylation
• Gene Information: human ... MIF(4282)

Description

General description

Macrophage migration inhibitory factor (MIF) is a 37.5kDa homotrimer protein. It is expressed in various cells like monocytes, macrophages, vascular smooth muscle cells (SMCs) and cardiomyocytes. This gene is located on human chromosome 21q22.33.(1)

This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. (provided by RefSeq)

Immunogen

MIF (AAH00447.1, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Biochem/physiol Actions

Macrophage migration inhibitory factor (MIF) can induce inflammation. Aberrations in MIF result in several inflammatory diseases, such as ulcerative colitis (UC), psoriasis and tuberculosis (TB).(1) It controls the anti-inflammator effects of glucocorticoids. MIF plays pro-inflammatory roles in inflammatory diseases like rheumatoid arthritis, sepsis, acute respiratory distress syndrome and glomerulonephritis.(2)

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves