Skip to Content
Merck
All Photos(2)

Key Documents

HPA014764

Sigma-Aldrich

Anti-DSE antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Chondroitin-glucuronate 5-epimerase, Anti-DS epimerase, Anti-DSE, Anti-Dermatan-sulfate epimerase precursor, Anti-SART-2, Anti-SART2 antibody produced in rabbit, Anti-Squamous cell carcinoma antigen recognized by T-cells 2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

FRKTAERLLRFSDKRQTEEAIDRIFAISQQQQQQSKSKKNRRAGKRYKFVDAVPDIFAQIEVNEKKIRQKAQILAQKELPIDEDEEMKDLLDFADVTYEKHKNGGLIKGRFGQARMVTTTHSRAPSLSASYT

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DSE(29940)

General description

DSE (dermatan sulfate epimerase) was initially identified as a squamous cell carcinoma antigen, and was named SART2 (squamous cell carcinoma antigen recognized by T cells 2). This protein is composed of 958 amino acids. It resides in endoplasmic reticulum and partly in Golgi bodies, and has its transmembrane domain at its N-terminal. It has four putative N-glycosylation sites, and its catalytic site is present at the groove of two domains. This gene is present on human chromosome 6q22, has six exons, and codes for a protein with molecular weight of 100kDa.

Immunogen

Dermatan-sulfate epimerase precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

DSE (dermatan sulfate epimerase) is responsible for the epimerization of GlcUA (glucuronic acid) into IdoUA (iduronic acid) in chondroitin chains, and the conversion of IdoUA into GlcUA in dermatans. Mutation in this gene is associated with musculocontractural Ehlers-Danlos syndromes (MCEDS), which is an outcome of abnormalities in dermatan sulfate (DS) synthesis. It is up-regulated in squamous cell carcinomas, and has three different N-glycosylated isoforms. It is also overexpressed in esophagus squamous cell carcinoma (ESCC), and its inactivation leads to reduced IdaUA levels, leading to decreased tumor migration and invasiveness. It is expressed in glioma, gynecological cancer, pancreatic cancer, colorectal carcinoma, and prostate cancer. Its expression is not seen in breast cancer cells.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73071

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Emil Tykesson et al.
The Journal of biological chemistry, 293(35), 13725-13735 (2018-07-07)
During the biosynthesis of chondroitin/dermatan sulfate (CS/DS), a variable fraction of glucuronic acid is converted to iduronic acid through the activities of two epimerases, dermatan sulfate epimerases 1 (DS-epi1) and 2 (DS-epi2). Previous in vitro studies indicated that without association
Thomas Müller et al.
Human molecular genetics, 22(18), 3761-3772 (2013-05-25)
The sulfated polysaccharide dermatan sulfate (DS) forms proteoglycans with a number of distinct core proteins. Iduronic acid-containing domains in DS have a key role in mediating the functions of DS proteoglycans. Two tissue-specific DS epimerases, encoded by DSE and DSEL
Marco Maccarana et al.
The Journal of biological chemistry, 281(17), 11560-11568 (2006-03-01)
We identified the gene encoding chondroitin-glucuronate C5-epimerase (EC 5.1.3.19) that converts D-glucuronic acid to L-iduronic acid residues in dermatan sulfate biosynthesis. The enzyme was solubilized from bovine spleen, and an approximately 43,000-fold purified preparation containing a major 89-kDa candidate component
Martin A Thelin et al.
Cancer research, 72(8), 1943-1952 (2012-02-22)
Extracellular matrix, either produced by cancer cells or by cancer-associated fibroblasts, influences angiogenesis, invasion, and metastasis. Chondroitin/dermatan sulfate (CS/DS) proteoglycans, which occur both in the matrix and at the cell surface, play important roles in these processes. The unique feature
M Nakao et al.
Journal of immunology (Baltimore, Md. : 1950), 164(5), 2565-2574 (2000-02-29)
Peptide-based specific immunotherapy has resulted in tumor regression in some melanoma patients. However, tumor Ags and peptides for specific immunotherapy, except for treatment of melanomas, have not yet been well identified. In this study, we report a gene encoding a

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service