Skip to Content
Merck
All Photos(1)

Key Documents

AV51358

Sigma-Aldrich

Anti-JPH2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-FLJ40969, Anti-JP-2, Anti-JP2, Anti-Junctophilin 2

Sign Into View Organizational & Contract Pricing
All Photos(1)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

74 kDa

species reactivity

dog, human, horse, guinea pig, bovine, rat, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

NP_065166

UniProt accession no.

Q9BR39

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... JPH2(57158)

Immunogen

Synthetic peptide directed towards the middle region of human JPH2

Application

Anti-JPH2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.

Biochem/physiol Actions

Junctophilin 2 (JPH2; CMH17) is a member of the junctophilin family. The members of this family form the junctional complexes present between the plasma membrane and the endoplasmic/sarcoplasmic reticululm. JPH2 couples the sarcolemmal and the intracellular calcium channels in the skeletal and cardiac muscle. The expression of JPH2 is essential for the formation of postnatal T-tubule in mammals. Dysregulation of junctophilins result in a variety of cardiac disorders.

Sequence

Synthetic peptide located within the following region: ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

David L Beavers et al.
Cardiovascular research, 103(2), 198-205 (2014-06-18)
Cardiomyocytes rely on a highly specialized subcellular architecture to maintain normal cardiac function. In a little over a decade, junctophilin-2 (JPH2) has become recognized as a cardiac structural protein critical in forming junctional membrane complexes (JMCs), which are subcellular domains
Andrew P Landstrom et al.
Trends in molecular medicine, 20(6), 353-362 (2014-03-19)
Excitable tissues rely on junctional membrane complexes to couple cell surface signals to intracellular channels. The junctophilins have emerged as a family of proteins critical in coordinating the maturation and maintenance of this cellular ultrastructure. Within skeletal and cardiac muscle
Alejandro Garbino et al.
Physiological genomics, 37(3), 175-186 (2009-03-26)
Junctophilins (JPHs) are members of a junctional membrane complex protein family important for the physical approximation of plasmalemmal and sarcoplasmic/endoplasmic reticulum membranes. As such, JPHs facilitate signal transduction in excitable cells between plasmalemmal voltage-gated calcium channels and intracellular calcium release
Yoshihisa Matsushita et al.
Journal of human genetics, 52(6), 543-548 (2007-05-04)
Junctophilin subtypes, designated as JPH1 approximately 4, are protein components of junctional complexes and play essential roles in cellular Ca2+ signaling in excitable cells. Knockout mice lacking the cardiac-type Jph2 die of embryonic cardiac arrest, and the mutant cardiac myocytes

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service