This product is a mixture of 22 peptides derived from the post-trypsin digest of QCAL. This is a lyophilized powder. Upon reconstitution with an appropriate solvent - typically 0.1% formic or trifluoroacetic acid in water - the solution is injection-ready. Please see the link below to review the product technical bulletin for further instructions for use:
https://www.sigmaaldrich.com/deepweb/assets/sigmaaldrich/product/documents/827/937/msqc2dat.pdf
MSQC2
MS QCAL Peptide Mix
lyophilized powder
Synonym(s):
MS Qual/Quant QC Mix, universal MS platform standard
Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
| Pack Size | SKU | Availability | Price |
|---|
About This Item
NACRES:
NA.24
UNSPSC Code:
12352200
Pricing and availability is not currently available.
form
lyophilized powder
analyte chemical class(es)
amino acids, peptides, proteins
technique(s)
HPLC: suitable
application(s)
food and beverages
format
multi-component solution
shipped in
ambient
storage temp.
2-8°C
General description
QCAL was designed using the QconCAT technology and recombinantly expressed in E. coli. The parent protein sequence of QCAL is as follows:
MGALRVFDEFKPLVEEPQNLIRVFDEFKPLVKPEEPQNLIRVFDEFKPLVKPEEKPQNLIRVFDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIKPRVFDEFQPLVEEPQNLIRGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGVNDNEEGFFSAKGGGVNDNEEGFFSARAVMDDFAAFVEKAVMMDDFAAFVEKAVMMMDDFAAFVEKGLVKFVVPRALELFRIGDYAGIKEALDFFARYLGYLEQLLRVLYPNDNFFEGKLFTFHADICTLPDTEKALVALVLVPRGSLEVLFQGPIEGRTENLYFQGDDDDKALVALVHHHHHH
QCAL was subsequently digested with trypsin to give a core mixture of 22 peptides.
MGALRVFDEFKPLVEEPQNLIRVFDEFKPLVKPEEPQNLIRVFDEFKPLVKPEEKPQNLIRVFDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIKPRVFDEFQPLVEEPQNLIRGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGVNDNEEGFFSAKGGGVNDNEEGFFSARAVMDDFAAFVEKAVMMDDFAAFVEKAVMMMDDFAAFVEKGLVKFVVPRALELFRIGDYAGIKEALDFFARYLGYLEQLLRVLYPNDNFFEGKLFTFHADICTLPDTEKALVALVLVPRGSLEVLFQGPIEGRTENLYFQGDDDDKALVALVHHHHHH
QCAL was subsequently digested with trypsin to give a core mixture of 22 peptides.
Application
MSQC2 is intended to act as a universal MS platform standard, by providing several elements for calibration and performance assessment, such as instrument resolution and linearity of signal detection.
This product is optimized to assess platform characteristics, including:
- Repeatability/Reproducibility between runs
- System stability (drift, chromatography, signal intensity, sensitivity, etc.)
- Inter- and intra- platform and lab comparisons
Features and Benefits
General
Complexity
Complexity
- Defined mixture gives confidence in your instruments analysis
Other Notes
Each vial contains 25 μg of lyophilized peptides that are derived from trypsin digestion of the protein concatamer QCAL.
1 of 1
This Item | |||
|---|---|---|---|
| form lyophilized powder | form - | form - | form ready-to-use solution |
| format multi-component solution | format multi-component solution | format multi-component solution | format multi-component solution |
| technique(s) HPLC: suitable | technique(s) HPLC: suitable, LC/MS: suitable | technique(s) HPLC: suitable, LC/MS: suitable | technique(s) HPLC: suitable, LC/MS: suitable |
| analyte chemical class(es) amino acids, peptides, proteins | analyte chemical class(es) amino acids, peptides, proteins | analyte chemical class(es) amino acids, peptides, proteins | analyte chemical class(es) amino acids, peptides, proteins |
| storage temp. 2-8°C | storage temp. −20°C | storage temp. −20°C | storage temp. −20°C |
| application(s) food and beverages | application(s) food and beverages | application(s) food and beverages | application(s) food and beverages |
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Storage Class
12 - Non Combustible Liquids
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Related Content
Claire E Eyers et al.
Journal of the American Society for Mass Spectrometry, 19(9), 1275-1280 (2008-07-05)
If proteome datasets are to be collated, shared, and merged for higher level proteome analyses, there is a need for generally accepted strategies and reagents for optimization and standardization of instrument performance. At present, there is no single protein or
Julie M Pratt et al.
Nature protocols, 1(2), 1029-1043 (2007-04-05)
An important area of proteomics involves the need for quantification, whether relative or absolute. Many methods now exist for relative quantification, but to support biomarker proteomics and systems biology, absolute quantification rather than relative quantification is required. Absolute quantification usually
Global Trade Item Number
| SKU | GTIN |
|---|---|
| MSQC2-2X25UG | 04061833254776 |
-
1. I would like to clarify whether this peptide quantity is based on the mass of the E.coli protein before trypsinization. 2. Is this product LC-MS injection-ready? 3. Please provide the protocol for this product.
1 answer-
Helpful?
-