AV32589
Anti-CHEK1 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-CHK1 checkpoint homolog (S. pombe)
Sign Into View Organizational & Contract Pricing
All Photos(2)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Pricing and availability is not currently available.
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
54 kDa
species reactivity
rat, human, rabbit, mouse, horse, dog
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CHEK1(1111)
General description
CHEK1 is a serine/threonine kinase that functions as a sensor for the stress response pathway in cells. It is activated by ATR kinase phosphorylation in response to DNA damage, and can subsequently modulate p53 phosphorylation. CHEK1 activity is inhibited by BCL6 in B cells.
Rabbit Anti-CHEK1 antibody recognizes zebrafish, bovine, chicken, human, mouse, rat, and canine CHEK1.
Rabbit Anti-CHEK1 antibody recognizes zebrafish, bovine, chicken, human, mouse, rat, and canine CHEK1.
Immunogen
Synthetic peptide directed towards the middle region of human CHEK1
Application
Rabbit Anti-CHEK1 antibody can be used for western blot applications at a concentration of 0.5μg/ml. It can also be used for immunohistochemistry at 4-8μg/ml.
Biochem/physiol Actions
CHEK1 is required during normal S phase to avoid aberrantly increased initiation of DNA replication, thereby protecting against DNA breakage. Its expression is dispensable for somatic cell death and critical for sustaining G2 DNA damage checkpoint.
Sequence
Synthetic peptide located within the following region: WSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLAL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Feng Li et al.
Nature communications, 12(1), 3845-3845 (2021-06-24)
Atr is a serine/threonine kinase, known to sense single-stranded DNA breaks and activate the DNA damage checkpoint by phosphorylating Chek1, which inhibits Cdc25, causing cell cycle arrest. This pathway has not been implicated in neuroregeneration. We show that in Drosophila
Stella M Ranuncolo et al.
Blood cells, molecules & diseases, 41(1), 95-99 (2008-03-19)
BCL6 is a transcriptional repressor protein that is expressed in a developmentally regulated fashion during B-cell maturation. Specifically, BCL6 is required for formation of germinal centers in response to T-cell dependent antigen activation. Germinal center B-cells feature the ability to
Hala Gali-Muhtasib et al.
Cancer research, 68(14), 5609-5618 (2008-07-18)
There are few reports describing the role of p53-dependent gene repression in apoptotic cell death. To identify such apoptosis-associated p53 target genes, we used the pro-oxidant plant-derived drug thymoquinone and compared p53+/+ and p53-/- colon cancer cells HCT116. The p53
Hanna Engqvist et al.
Frontiers in oncology, 10, 162-162 (2020-03-07)
Early-stage (I and II) ovarian carcinoma patients generally have good prognosis. Yet, some patients die earlier than expected. Thus, it is important to stratify early-stage patients into risk groups to identify those in need of more aggressive treatment regimens. The
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
