WH0117581M1

Monoclonal Anti-TWIST2 antibody produced in mouse

clone 3C8, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-DERMO1, Anti-MGC117334, Anti-twist homolog 2 (Drosophila)
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 3C8, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG1κ
• Numéro d'accès GenBank: BC033168
• Numéro d'accès UniProt: Q8WVJ9
• Application(s): research pathology
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TWIST2(117581)

Description

Description générale

Twist family bHLH transcription factor 2 (TWIST2) is part of the basic helix-loop-helix protein (bHLH) family. It acts as a molecular switch by activating or repressing target genes. The TWIST2 gene is localized on human chromosome 2q37.3.

Immunogène

TWIST2 (AAH33168, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGSWSMSASH

Application

Monoclonal Anti-TWIST2 antibody produced in mouse has been used in immunohistochemistry.

Actions biochimiques/physiologiques

Twist family bHLH transcription factor 2 (TWIST2) modulates transcription in mesenchymal cell lineages during development. It interacts with E-protein modulators and binds with E-box on DNA sequences. Mutations in the TWIST2 gene have been linked with Setleis syndrome.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): nwg
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)