WH0009735M1

Monoclonal Anti-KNTC1 antibody produced in mouse

clone 10H4, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-KIAA0166, Anti-ROD, Anti-kinetochore associated 1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 10H4, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès GenBank: NM_014708
• Numéro d'accès UniProt: P50748
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... KNTC1(9735)

Description

Description générale

This gene encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. Experimental evidence indicated that the encoded protein functioned in a similar manner to that of the Drosophila rough deal protein. (provided by RefSeq)

Immunogène

KNTC1 (NP_055523, 2100 a.a. ~ 2209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DPQVILKQLEEHMNTGQLAGFSHQIRSLILNNIINKKEFGILAKTKYFQMLKMHAMNTNNITELVNYLANDLSLDEASVLITEYSKHCGKPVPPDTAPCEILKMFLSGLS

Actions biochimiques/physiologiques

KNTC1 (kinetochore associated 1) is part of the RZZ (Rod–Zw10–Zwilch) complex which is needed for proper kinetochore recruitment. Absence of KNTC1 causes checkpoint failure and early exit from mitosis.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)