WH0009212M3

Monoclonal Anti-AURKB antibody produced in mouse

clone 6H7, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-AIK2, Anti-AIM1, Anti-ARK2, Anti-AurB, Anti-IPL1, Anti-STK12, Anti-STK5, Anti-aurora kinase B
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 6H7, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): immunofluorescence: suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG1κ
• Numéro d'accès GenBank: BC009751
• Numéro d'accès UniProt: Q96GD4
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... AURKB(9212)

Description

Description générale

Chromosomal segregation during mitosis as well as meiosis is regulated by kinases and phosphatases. The Aurora kinases associate with microtubules during chromosome movement and segregation. Aurora kinase B localizes to microtubules near kinetochores, specifically to the specialized microtubules called K-fibers, and Aurora kinase A (MIM 603072) localizes to centrosomes (Lampson et al., 2004 [PubMed 14767480]).[supplied by OMIM

Immunogène

AURKB (AAH09751, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGN

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)