Accéder au contenu
Merck
Toutes les photos(5)

Key Documents

WH0007855M1

Sigma-Aldrich

Monoclonal Anti-FZD5 antibody produced in mouse

clone 6A3, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-HFZ5, Anti-frizzled homolog 5 (Drosophila)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(5)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

6A3, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunoprecipitation (IP): suitable
indirect ELISA: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

NM_003468

Numéro d'accès UniProt

Q13467

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... FZD5(7855)

Catégories apparentées

Description générale

The frizzled class receptor 5 (FZD5) gene encodes a receptor FZ5 for Wnt proteins and it is localized on human chromosome 2q33.3.

Immunogène

FZD5 (ENSP00000354607, 72 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPR

Actions biochimiques/physiologiques

Frizzled class receptor 5 (FZD5) is a receptor component for the canonical and non-canonical Wnt signaling pathways, which is necessary for cell proliferation and cell differentiation. It might serve as an important biomarker for eye malformation. The Wnt5a-FZD5 complex is known to support the functions of innate immunity. Fzd5, along with GCM1 (chorion-specific transcription factor), is involved in a feedback mechanism that regulates trophoblast differentiation and chorionic branching in placenta.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Functional analysis of dishevelled-3 phosphorylation identifies distinct mechanisms driven by casein kinase 1? and frizzled5.
Bernatik O
The Journal of Biological Chemistry (2014)
A secreted WNT-ligand-binding domain of FZD5 generated by a frameshift mutation causes autosomal dominant coloboma.
Liu C
Human Molecular Genetics (2016)
Wnt5a-Rac1-NF-?B homeostatic circuitry sustains innate immune functions in macrophages.
Naskar D
Journal of Immunology (2014)
A positive feedback loop involving Gcm1 and Fzd5 directs chorionic branching morphogenesis in the placenta.
Lu J
PLoS Biology (2013)
Strong linkage on 2q33.3 to familial early-onset generalized osteoarthritis and a consideration of two positional candidate genes.
Meulenbelt I
European Journal of Human Genetics (2006)
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique