WH0007153M1

Monoclonal Anti-TOP2A antibody produced in mouse

clone 1E2, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-TOP2, Anti-TP2A, Anti-topoisomerase (DNA) II alpha 170kDa
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 1E2, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotype: IgG1κ
• Numéro d'accès GenBank: NM_001067
• Numéro d'accès UniProt: P11388
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TOP2A(7153)

Description

Description générale

This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromsome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia. (provided by RefSeq)

Immunogène

TOP2A (NP_001058, 1435 a.a. ~ 1531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF

Actions biochimiques/physiologiques

Topoisomerase II A (TOP2A) enzyme plays a vital role in DNA replication and cell proliferation. Experimental studies show an increased expression of this enzyme in Chinese patients with gastric carcinoma. DNA topoisomerase 2-α acts as a target enzyme for an anthracycline drug called as epirubicin and many other antineoplastic drugs. Top2α is involved in reducing the topological stress in cells. The hsa-miR-485-3p downregulates the expression of nuclear transcription factor Y subunit β (NFYB), which acts as a mediator of Top2α. Consequently, it decreases the expression of Top2α and its drug responsiveness. Top2α enzyme plays an important role in maintenance of chromosome condensation and segregation. Ataxia telangiectasia mutated (ATM)-dependent regulation of TOP2A helps in TOP2 stability and also it′s sensitivity to TOP2 inhibitor.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)