SAB5702069

Anti-β-Tubulin III Antibody

rabbit monoclonal, 6X6H6

• Synonyme(s) : CDCBM,CDCBM1,CFEOM3,CFEOM3A,FEOM3,TUBB4,beta-4,beta Tubulin III,TUBB3
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• product name: Anti-βIII-Tubulin Antibody, clone 6X6H6, Rabbit Monoclonal,
• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 6X6H6, monoclonal
• Forme: liquid
• Poids mol.: 50 kDa
• Espèces réactives: rat, rat, human
• Concentration: 0.33 mg/mL
• Technique(s): immunofluorescence: 1:50 - 1:200; immunoprecipitation (IP): 1:50 - 1:200; western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: VAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK
• Numéro d'accès UniProt: Q13509
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TUBB3(10381)

Description

Description générale

This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6. [provided by RefSeq, Oct 2010]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 351-450 of human βIII-Tubulin/β3-Tubulin (Q13509).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IF/ICC, IP

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1