SAB2108849

Anti-PIEZO2 (N-terminal) antibody produced in rabbit HRP conjugated

affinity isolated antibody

• Synonyme(s) : GH, GH-N, GHN, IGHD1B, hGH-N
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.45

Propriétés

• Source biologique: rabbit
• Conjugué: peroxidase conjugate
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 77 kDa
• Réactivité de l'espèce (prédite par homologie): mouse, human, canine, rat, horse, bovine, guinea pig, rabbit
• Concentration: 0.5 mg/mL
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PIEZO2(63895)

Description

Description générale

Piezos are large transmembrane proteins conserved among various species, all having between 24 and 36 predicted transmembrane domains. ′Piezo′ comes from the Greek ′piesi,′ meaning ′pressure.′ The PIEZO2 protein has a role in rapidly adapting mechanically activated (MA) currents in somatosensory neurons.

Immunogène

Synthetic peptide directed towards the N-terminal region of Human PIEZO2

Séquence

Synthetic peptide located within the following region: VFGFWAFGKHSAAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRK

Forme physique

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 12 - Non Combustible Liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable