SAB2102168

Anti-SLC16A6 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-MCT6, Anti-MCT7, Anti-Solute carrier family 16, member 6 (monocarboxylic acid transporter 7)
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 57 kDa
• Espèces réactives: rabbit, horse, human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès UniProt: O15403
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: human ... SLC16A6(9120)

Description

Immunogène

Synthetic peptide directed towards the middle region of human SLC16A6

Actions biochimiques/physiologiques

SLC16A6 is a proton-linked monocarboxylate transporter.It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.

Séquence

Synthetic peptide located within the following region: ILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable