SAB1412637

ANTI-SMG1 antibody produced in mouse

clone 2B10, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : 61E3.4, ATX, KIAA0421, LIP, SMG1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 2B10, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen 37.84 kDa
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG1κ
• Numéro d'accès NCBI: NM_014006
• Numéro d'accès UniProt: Q96Q15
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SMG1(23049)

Description

Description générale

This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternative spliced transcript variants have been described, but their full-length natures have not been determined. (provided by RefSeq)

Immunogène

SMG1 (NP_055535, 2922 a.a. ~ 3031 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable