SAB1402393

Monoclonal Anti-WNT5A antibody produced in mouse

clone 3A4, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : hWNT5A
• Numéro MDL: MFCD07784920
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 3A4, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~37.11 kDa
• Espèces réactives: human
• Technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable
• Isotype: IgG2aκ
• Numéro d'accès NCBI: BC064694
• Numéro d'accès UniProt: P41221
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... WNT5A(7474)

Description

Description générale

Wnt family member 5A (WNT5A) is a secreted, proinflammatory protein. It is part of the noncanonical WNT family. The gene encoding this protein is localized on human chromosome 3p14.3.

Immunogène

WNT5A (AAH64694, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV

Actions biochimiques/physiologiques

Wnt family member 5A (WNT5A) has a role in metabolic dysfunction in obesity and negatively modulates angiogenesis in adipose tissue. The protein regulates cell motility and polarity by activating β-catenin–independent pathways. It has been shown to be overexpressed in gliomas.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable