Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

SAB1402157

Sigma-Aldrich

Monoclonal Anti-CRY2 antibody produced in mouse

clone 3H4, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

FLJ10332, HCRY2, KIAA0658, PHLL2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.43

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3H4, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~36.12 kDa

Espèces réactives

human

Technique(s)

capture ELISA: suitable
immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CRY2(1408)

Catégories apparentées

Description générale

Cryptochrome circadian regulator 2 (CRY2) is a core circadian gene and transcriptional repressor. CRY2 gene is located on the human chromosome 11p11.2.

Immunogène

CRY2 (NP_066940.1, 141 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQG

Actions biochimiques/physiologiques

Cryptochrome circadian regulator 2 (CRY2) is involved in DNA damage checkpoint control and cell cycle progression. It maintains the circadian rhythm through a circadian feedback loop. It is also important in immune system coordination and hematologic system development. CRY2 is a potential circadian biomarker for non-Hodgkin′s lymphoma (NHL). CRY2 is linked to rapid cycling in bipolar disorder. CRY2 functions as light-sensitive magnetosensor.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

CRY2 is associated with rapid cycling in bipolar disorder patients
Sjoholm LK, et al.
Testing, 5(9), e12632-e12632 (2010)
Variants in circadian genes and prostate cancer risk: a population-based study in China
Chu Lw, et al.
Prostate Cancer and Prostatic Diseases, 11(4), 342-342 (2008)
Clock-Cancer Connection in Non-Hodgkin's Lymphoma: A Genetic Association Study and Pathway Analysis of the Circadian Gene Cryptochrome 2
Hoffman AE, et al.
Cancer Research, 69(8), 3605-3613 (2009)
Human cryptochrome exhibits light-dependent magnetosensitivity
Foley LE, et al.
Nature Communications, 2, 356-356 (2011)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique