Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

View All Documentation

MSST0045

Sigma-Aldrich

SILu™Prot TIMP2, Metalloproteinase inhibitor 2 human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C and 15N-labeled

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
23201100
Nomenclature NACRES :
NA.12

Produit recombinant

expressed in HEK 293 cells

Niveau de qualité

200

Pureté

≥98% (SDS-PAGE)

Forme

lyophilized powder

Puissance

≥98% Heavy amino acids incorporation efficiency by MS

Adéquation

suitable for mass spectrometry (standard)

Numéro d'accès UniProt

P16035

Température de stockage

−20°C

Description générale

SILu™Prot TIMP2 is a recombinant, stable isotope-labeled human TIMP2 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of TIMP2 in mass-spectrometry. SILu™Prot TIMP2 is a protein of 194 amino acids , with a calculated molecular mass of 21.7 kDa.

Actions biochimiques/physiologiques

While the mammalian TIMP family has four members, TIMP-2 is a unique family member in that in addition to inhibiting matrix metalloproteinases (MMPs), TIMP-2 selectively interacts with MT1-MMP to facilitate the cell-surface activation of pro-MMP-2.1 Thus, TIMP-2 functions both as an inhibitor of MMPs, and is required for the cellular mechanism of pro-MMP-2 activation. Recently, it was validated that combination of TIMP-2 with another urinary cell-cycle arrest biomarkers, i.e. the insulin-like growth factor-binding protein 7 (IGFBP7) may predict the risk of moderate and severe acute kidney injury (AKI) in critically ill patients. For postoperative surgical intensive care unit patients, a single urinary TIMP2•IGFBP7 test accurately identified patients at risk for developing AKI within the ensuing 12 hours and its inclusion in clinical risk prediction models significantly enhances their performance.

Séquence

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Forme physique

Supplied as a lyophilized powder containing phosphate buffered saline.

Informations légales

SILu is a trademark of Sigma-Aldrich Co. LLC

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique