HPA036528

Anti-WAC antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-BM-016, Anti-FLJ31290, Anti-MGC10753, Anti-PRO1741, Anti-WW domain containing adaptor with coiled-coil, Anti-Wwp4
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA036528
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunohistochemistry: 1:50- 1:200
• Séquence immunogène: RLSDGCHDRRGDSQPYQALKYSSKSHPSSGDHRHEKMRDAGDPSPPNKMLRRSDSPENKYSDSTGHSKAKNVHTHRVRERDGGTSYSPQENSH
• Numéro d'accès UniProt: Q9BTA9
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... WAC(51322)

Description

Description générale

WAC (WW domain-containing adaptor protein) is present on human chromosome 10p12.1. It has a coiled coil domain and exists in four isoforms.

Immunogène

WW domain containing adaptor with coiled-coil recombinant protein epitope signature tag (PrEST)

Application

Anti-WAC antibody produced in rabbit can be used for the detection of WAC protein in human embryonic kidney cells 293 lysate by immunoblotting. It may also be used for the detection of WAC proteins in HeLa cells by immunoblotting.

Actions biochimiques/physiologiques

WW domain-containing protein associates with Golgi matrix protein 120 and regulates generation of autophagosomes. During amino acid starvation, WAC also interacts with Golgi protein short coiled-coil protein (SCOC) to mediate autophagy. The coiled coil domain of WAC interacts with ubiquitin-protein ligase complex and aids in ubiquitination of histone H2B, favoring gene expression. WAC assists in the activation and entry of polo-like kinase into mitotic cycle. Microdeletions and de novo mutation in the WAC genome locus is associated with behavior disorders, developmental delay and facial abnormalities in children. Nonsense and frameshift mutations in the WAC gene results in a truncated protein product leading to hypotonia, interrupted development and dysmorphic facial features.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST80181

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable