HPA030751

Anti-OGT antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab1

• Synonyme(s) : Anti-FLJ23071, Anti-HRNT1, Anti-MGC22921, Anti-O-GLCNAC, Anti-O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)
• Numéro MDL: MFCD07370422
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA030751
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human, mouse, rat
• Validation améliorée: independent; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50
• Séquence immunogène: LYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWA
• Numéro d'accès UniProt: O15294
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... OGT(8473)

Description

Description générale

OGT (O-linked N-acetylglucosamine transferase) gene is mapped to human chromosome Xq13.1. This gene encodes for nucleo cytosolic and mitochondrial isoforms of the enzyme. OGT is highly conserved among Caenorhabditis elegans, rat, and human genomes, sharing over 65% amino acid identity. The gene includes multiple tandem tetratricopeptide repeat sequences and is modified by O-GlcNA (O-linked N-acetylglucosamine), also by tyrosine phosphorylation.

Immunogène

O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase) recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-OGT antibody produced in rabbit has been used in western blotting.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Actions biochimiques/physiologiques

O-GlcNAc (O-linked N-acetylglucosamine) transferase (OGT) catalyzes O-GlcNAcylation that occurs in mitochondria, nuclear, and cytoplasmic proteins. O-GlcNAc transferase is a subunit of nonspecific lethal complex, a transcriptional regulator. O-GlcNAcylation involves the addition of O-GlcNAc to specific serine or threonine residue on many of the cytosolic and nuclear proteins. Disturbance in O-GlcNAcylation is associated with the development of diseases including cancer, diabetes, and Alzheimer disease. OGT is associated with increased mitochondrial respiration and elevated glycolysis. Inhibition in addition or removal of O-GlcNAc leads to a defect in preinitiation complex assembly.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST78284

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable