Accéder au contenu
Merck
Toutes les photos(5)

Key Documents

View All Documentation

HPA001562

Sigma-Aldrich

Anti-ATF3 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

ATF3 Antibody - Anti-ATF3 antibody produced in rabbit, Atf3 Antibody, Anti-Activating transcription factor 3 antibody produced in rabbit, Anti-Cyclic AMP-dependent transcription factor ATF-3 antibody produced in rabbit

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(5)

About This Item

Numéro MDL:
MFCD01092265
Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
HPA001562
Nomenclature NACRES :
NA.43

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

Séquence immunogène

MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC

Numéro d'accès UniProt

P18847

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ATF3(467)

Description générale

Activating transcription factor 3 (ATF3) gene is mapped to human chromosome 1q32.3. The encoded protein belongs to the cAMP-response element binding (CREB) protein family.
Rabbit polyclonal anti-ATF3 antibody reacts with human activating transcription factor 3.

Immunogène

Cyclic AMP-dependent transcription factor ATF-3 recombinant protein epitope signature tag (PrEST)

Application

Anti-ATF3 antibody produced in rabbit has been used in:
  • western blotting
  • immunofluorescence
  • immunohistochemical staining
  • chromatin immunoprecipitation (ChIP)

Actions biochimiques/physiologiques

Activating transcription factor 3 (ATF3), a cyclic AMP-dependent transcription factor stimulates transcription by sequestering inhibitory cofactors. ATF3 responds to stress signals and is involved in the regulation of immune and metabolic homeostasis. It helps to prevent chronic inflammation and starvation responses. ATF3 expression is induced in response to eye injury. It serves as a marker for neuronal injury.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST77475

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Marta Bueno et al.
Aging cell, 17(2) (2018-01-25)
PINK1 (PTEN-induced putative kinase 1) is a key regulator of mitochondrial homeostasis that is relatively depleted in aging lungs and in lung epithelial cells from patients with idiopathic pulmonary fibrosis (IPF), a disease linked with aging. Impaired PINK1 expression and
Activating transcription factor 3 promotes embryo attachment via up-regulation of leukemia inhibitory factor in vitro
Cheng X, et al.
Reproductive Biology and Endocrinology, 15(1), 42-42 (2017)
A potential dichotomous role of ATF3, an adaptive-response gene, in cancer development
Yin X, et al.
Oncogene, 27(15), 2118-2118 (2008)
Activating transcription factor 3 (ATF3) expression in the neural retina and optic nerve of zebrafish during optic nerve regeneration
Saul KE, et al.
Comparative Biochemistry and Physiology. Part A, Molecular & Integrative Physiology, 155(2), 172-182 (2010)
Makoto Edagawa et al.
The Journal of biological chemistry, 289(31), 21544-21561 (2014-06-19)
Death receptor 5 (DR5) is a death domain-containing transmembrane receptor that triggers cell death upon binding to its ligand, TNF-related apoptosis-inducing ligand (TRAIL), and a combination of TRAIL and agents that increase the expression of DR5 is expected to be
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique