AV50251
Anti-COX3 antibody produced in rabbit
affinity isolated antibody
Synonyme(s) :
Anti-Cytochrome c oxidase III
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
29 kDa
Espèces réactives
human
Concentration
0.5 mg - 1 mg/mL
Technique(s)
western blot: suitable
Numéro d'accès NCBI
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... MTCO3(4514)
Description générale
Mitochondrially encoded cytochrome c oxidase III (MT-CO3; COX3) is encoded by the mitochondrial DNA and localizes to the inner mitochondrial membrane. COX3 is generally mentioned as COXIII.
Immunogène
Synthetic peptide directed towards the C terminal region of human COX3
Application
Anti-COX3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Actions biochimiques/physiologiques
Cytochrome oxidases make up the terminal complex of the electron transport chain in the mitochondria. Deletions in mitochondrially encoded cytochrome c oxidase III (MT-CO3; COX3) gene are associated with rhabdomyolysis. Mutation in COX3 is linked to maternally inherited diabetes and deafness associated with nephropathy. COX3 mutations have been observed in asthenozoospermic infertile men, patients with MELAS (mitochondrial encephalomyopathy, lactic acidosis and stroke-like episodes) and Leber hereditary optic neuropathy. Hepatitis B virus X protein interacts with COX3 and the intercation might be crucial for hepatocarcinoma tumorigenesis.
Séquence
Synthetic peptide located within the following region: FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKH
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Siwar Baklouti-Gargouri et al.
Journal of assisted reproduction and genetics, 31(5), 595-600 (2014-02-20)
Infertility affects 10-15 % of the population, of which, approximately 40 % is due to male etiology consisting primarily of low sperm count (oligozoospermia) and/or abnormal sperm motility (asthenozoospermia). It has been demonstrated that mtDNA base substitutions can greatly influence
Structure and function of cytochrome c oxidase.
R A Capaldi
Annual review of biochemistry, 59, 569-596 (1990-01-01)
D R Johns et al.
Biochemical and biophysical research communications, 196(2), 810-815 (1993-10-29)
New mitochondrial DNA mutations were discovered in the cytochrome c oxidase subunit III gene in 8 independent Leber hereditary optic neuropathy probands. A mutation at nucleotide position 9438 was found in 5 probands, changed highly conserved glycine-78 to serine (G78S)
G Manfredi et al.
Neuromuscular disorders : NMD, 5(5), 391-398 (1995-09-01)
We report a patient with mitochondrial encephalomyopathy, lactic acidosis and stroke-like episodes (MELAS) who harbored a novel missense mutation at mtDNA position 9957 in the gene specifying subunit III of cytochrome c oxidase (COX III). This T-->C transition converted Phe-251
Mouna Tabebi et al.
Biochemical and biophysical research communications, 459(3), 353-360 (2015-02-24)
Mitochondrial diabetes (MD) is a heterogeneous disorder characterized by a chronic hyperglycemia, maternal transmission and its association with a bilateral hearing impairment. Several studies reported mutations in mitochondrial genes as potentially pathogenic for diabetes, since mitochondrial oxidative phosphorylation plays an
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique