AV49932
Anti-PLXNA2 antibody produced in rabbit
affinity isolated antibody
Synonyme(s) :
Anti-FLJ11751, Anti-FLJ30634, Anti-KIAA0463, Anti-OCT, Anti-PLXN2, Anti-Plexin A2
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
211 kDa
Espèces réactives
mouse, rat, horse, dog, guinea pig, rabbit, human
Concentration
0.5 mg - 1 mg/mL
Technique(s)
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... PLXNA2(5362)
Description générale
In the fetal samples, Plexin A2 (PLXNA2) has prominent expression in fetal neural tissue.
Immunogène
Synthetic peptide directed towards the N terminal region of human PLXNA2
Application
Anti-PLXNA2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Actions biochimiques/physiologiques
Plexin A2 (PLXNA2) is a coreceptor for semaphorins that are involved in immune responses, activation of immune cells and axon guidance during neuronal development. PLXNA2 acts as a receptor of Sema6A and has a role in limiting adult axon growth and recovery post trauma. PLXNA2 is up-regulated in metastatic prostate cancer tumors and breast cancer. Copy number variation in PLXNA2 is associated with Tetralogy of Fallot (TOF), a cyanotic congenital heart disease. Dysregulation of PLXNA2-semaphorin signaling results in congenital heart disease, characteristic of cardiac outflow tract (OFT) defect. PLXNA2 is up-regulated by osteogenic factor BMP2. Up-regulated PLXNA2 mediates osteoblast differentiation by regulation of RUNX2 (Runt-related transcription factor 2) expression.
Séquence
Synthetic peptide located within the following region: SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPIL
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
T V Tian et al.
Oncogene, 33(17), 2204-2214 (2013-05-28)
Prostate cancer (PCa) is one of the major public health problems in Western countries. Recently, the TMPRSS2:ERG gene fusion, which results in the aberrant expression of the transcription factor ERG, has been shown to be the most common gene rearrangement
P N Gabrovska et al.
Gene, 489(2), 63-69 (2011-09-20)
Gene expression profiling has enabled us to demonstrate the heterogeneity of breast cancers. The potential of a tumour to grow and metastasise is partly dependant on its ability to initiate angiogenesis or growth and remodelling of new blood vessels, usually
Candice K Silversides et al.
PLoS genetics, 8(8), e1002843-e1002843 (2012-08-23)
Structural genetic changes, especially copy number variants (CNVs), represent a major source of genetic variation contributing to human disease. Tetralogy of Fallot (TOF) is the most common form of cyanotic congenital heart disease, but to date little is known about
Sang-Ohk Shim et al.
Molecular and cellular neurosciences, 50(2), 193-200 (2012-05-09)
Axonal growth from both intact and severed fibers is limited after adult mammalian CNS injury. Myelin proteins contribute to inhibition of axonal growth. Semaphorin6A protein inhibits the extension of developing axons and is highly expressed in adult oligodendrocytes. This expression
Ji-Eun Oh et al.
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research, 27(3), 552-562 (2011-11-19)
The imbalance between bone-resorbing osteoclasts and bone-forming osteoblasts often leads to bone destructive diseases such as osteoporosis. In contrast to the development of several antiresorptive agents for osteoporosis therapy, discovery of anabolic drugs has been difficult because of an insufficient
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique