AV44249
Anti-PTCH1 antibody produced in rabbit
affinity isolated antibody
Synonyme(s) :
Anti-Patched homolog 1 (Drosophila)
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
37 kDa
Espèces réactives
dog, bovine, horse, human, mouse, guinea pig, rat
Concentration
0.5 mg - 1 mg/mL
Technique(s)
immunohistochemistry: suitable
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... PTCH1(5727)
Description générale
Protein patched homolog 1 (PTCH1) is the receptor for secreted sonic hedgehog ligand and belongs to the patched gene family. It is mapped to human chromosome 9q22.32. Ptch1 has 12 transmembrane regions, intracellular middle-loop domain (MLD) and C-terminal domain (CTD) essential for oligomerization.
Immunogène
Synthetic peptide directed towards the C terminal region of human PTCH1
Application
Anti-PTCH1 antibody produced in rabbit has been used in Flow cytometry/Cell sorting. It is suitable for western blotting at a concentration of 0.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Flow cytometry/Cell sorting (1 paper)
Flow cytometry/Cell sorting (1 paper)
Actions biochimiques/physiologiques
Mutations in protein patched homolog 1(PTCH1) is implicated in autosomal dominant disorder called the Gorlin syndrome, resulting in developmental abnormalities.
PTCH1 (patched 1; PTC) activates the sonic hedgehog (Hh) signaling pathway that is involved in the development of embryonic structures. PTCH1 is a tumor suppressor that maintains the activity of GLI1, the downstream target of Hh signaling. Mutations and methylation status in PTCH1 gene result in tumorigenesis and malignancy in cancers including colorectal, gastric, melanoma and osteosarcoma.
Séquence
Synthetic peptide located within the following region: TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Jon H Chung et al.
Oncotarget, 4(12), 2208-2211 (2013-12-26)
Hedgehog (Hh) signaling is largely suppressed in the normal differentiated tissues of the adult but activated in many cancers. The Hh pathway can either be activated by the expression of Hh ligands, or by mutations that cause constitutive, ligand-independent signaling.
Swan Hwang et al.
PloS one, 8(7), e68271-e68271 (2013-08-13)
The sonic hedgehog (Shh) signaling pathway is necessary for a variety of development and differentiation during embryogenesis as well as maintenance and renascence of diverse adult tissues. However, an abnormal activation of the signaling pathway is related to various cancers.
The protein-specific activities of the transmembrane modules of Ptch1 and Ptch2 are determined by their adjacent protein domains
Fleet AJ and Hamel PA
The Journal of Biological Chemistry, 293(43), 16583-16595 (2018)
Coincident PTCH and BRCA1 germline mutations in a patient with nevoid basal cell carcinoma syndrome and familial breast cancer.
Reifenberger J, et al.
The Journal of Investigative Dermatology, 116(3), 472-474 (2001)
Yun Zuo et al.
Experimental and therapeutic medicine, 6(6), 1365-1368 (2013-11-21)
The aim of this study was to investigate the correlation between patched 1 (PTCH1) expression and its methylation in a human gastric cancer cell line, in order to provide new information regarding carcinogenesis and the development of gastric cancer. Quantitative
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique