Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

AV44176

Sigma-Aldrich

Anti-SLC26A5 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-DFNB61, Anti-MGC118886, Anti-MGC118887, Anti-MGC118888, Anti-MGC118889, Anti-PRES, Anti-Solute carrier family 26, member 5 (prestin)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

81 kDa

Espèces réactives

horse, guinea pig, dog, rabbit, bovine, rat, mouse, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_945350

Numéro d'accès UniProt

P58743

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SLC26A5(375611)

Catégories apparentées

Immunogène

Synthetic peptide directed towards the middle region of human SLC26A5

Application

Anti-SLC26A5 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Actions biochimiques/physiologiques

SLC26A5 (Prestin), a member of SLC26 family, is an anion transporter that functions at microsecond rates. It is expressed at the basolateral membrane of cochlear outer hair cells and modulates the sensitivity of mammalian hearing. Mutations in the gene encoding for prestin result in neurosensory deafness.

Séquence

Synthetic peptide located within the following region: FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Dmitry Gorbunov et al.
Nature communications, 5, 3622-3622 (2014-04-09)
Prestin (SLC26A5) is a member of the SLC26/SulP anion transporter family. Its unique quasi-piezoelectric mechanical activity generates fast cellular motility of cochlear outer hair cells, a key process underlying active amplification in the mammalian ear. Despite its established physiological role
Dalian Ding et al.
Frontiers in cell and developmental biology, 9, 643709-643709 (2021-06-11)
2-Hyroxypropyl-beta-cyclodextrin (HPβCD) is being used to treat Niemann-Pick C1, a fatal neurodegenerative disease caused by abnormal cholesterol metabolism. HPβCD slows disease progression, but unfortunately causes severe, rapid onset hearing loss by destroying the outer hair cells (OHC). HPβCD-induced damage is
Seth L Alper et al.
Molecular aspects of medicine, 34(2-3), 494-515 (2013-03-20)
The phylogenetically ancient SLC26 gene family encodes multifunctional anion exchangers and anion channels transporting a broad range of substrates, including Cl(-), HCO3(-), sulfate, oxalate, I(-), and formate. SLC26 polypeptides are characterized by N-terminal cytoplasmic domains, 10-14 hydrophobic transmembrane spans, and

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique