Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

AV43810

Sigma-Aldrich

Anti-SLC38A1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-ATA1, Anti-NAT2, Anti-SAT1, Anti-SNAT1, Anti-Solute carrier family 38, member 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

54 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SLC38A1(81539)

Description générale

Solute carrier family 38, member 1/sodium-coupled neutral amino acid transporter 1 (SLC38A1, ATA1, NAT2, SAT1, SNAT1), which is expressed during embryogenesis, is a sodium-dependent transporter of neutral zwitterionic amino acids, such a glutamine. SLC38A1/SAT1 is believed to be involved in translocation of glutamine into GABAergic neurons to facilitate inhibitory neurotransmitter generation.

Spécificité

Anti-SLC38A1 (AB1) polyclonal antibody reacts with canine and human solute carrier family 38, member 1 proteins.

Immunogène

Synthetic peptide directed towards the middle region of human SLC38A1

Application

Anti-SLC38A1 (AB1) polyclonal antibody is used to tag solute carrier family 38, member 1/sodium-coupled neutral amino acid transporter for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 38, member 1 in transport of important neutral zwitterionic amino acids, such a glutamine, during embryogenesis and in neural function.

Actions biochimiques/physiologiques

Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate.

Séquence

Synthetic peptide located within the following region: LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

O R Vaughan et al.
Journal of molecular endocrinology, 63(4), 239-248 (2019-09-11)
Excess maternal glucocorticoids reduce placental amino acid transport and fetal growth, but whether these effects are mediated directly on the syncytiotrophoblast remains unknown. We hypothesised that glucocorticoids inhibit mechanistic target of rapamycin (mTOR) signaling and insulin-stimulated System A amino acid

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique