Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV38693

Sigma-Aldrich

Anti-SMAD1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-SMAD family member 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

51 kDa

Espèces réactives

bovine, rabbit, guinea pig, mouse, horse, rat, dog, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_001120689

Numéro d'accès UniProt

Q15797

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... SMAD1(4086)

Immunogène

Synthetic peptide directed towards the C terminal region of human SMAD1

Actions biochimiques/physiologiques

SMAD proteins are transcription regulators that mediate multiple signal transduction pathways. They are involved in a wide variety of cellular processes such as cell growth, apoptosis, survival, differentiation, morphogenesis and immune responses. SMAD1 interacts with PAWS1/FAM83G protein and regulates bone morphogenetic protein signaling.

Séquence

Synthetic peptide located within the following region: FVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Toshio Matsumoto et al.
Endocrine journal, 59(2), 91-101 (2011-09-21)
Mechanical stress and parathyroid hormone (PTH) are major stimulators, and aging and glucocorticoids excess are important suppressors of osteoblast differentiation. Mechanical stress and PTH stimulate interleukin (IL)-11 expression in cells of osteoblast lineage by enhancing transcription of IL-11 gene via
Janis Vogt et al.
Open biology, 4, 130210-130210 (2014-02-21)
Bone morphogenetic proteins (BMPs) control multiple cellular processes in embryos and adult tissues. BMPs signal through the activation of type I BMP receptor kinases, which then phosphorylate SMADs 1/5/8. In the canonical pathway, this triggers the association of these SMADs
Tamás Juhász et al.
Journal of molecular neuroscience : MN, 54(3), 555-573 (2014-08-13)
Presence of the pituitary adenylate cyclase-activating polypeptide (PACAP) signalling has been proved in various peripheral tissues. PACAP can activate protein kinase A (PKA) signalling via binding to pituitary adenylate cyclase-activating polypeptide type I receptor (PAC1), vasoactive intestinal polypeptide receptor (VPAC)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique