Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV36019

Sigma-Aldrich

Anti-EBF2 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-COE2, Anti-EBF-2, Anti-Early B-cell factor 2, Anti-FLJ11500, Anti-O/E-3, Anti-OE-3

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

61 kDa

Espèces réactives

human, rat, rabbit, guinea pig, horse, mouse, bovine

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_073150

Numéro d'accès UniProt

Q9HAK2

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... EBF2(64641)

Catégories apparentées

Immunogène

Synthetic peptide directed towards the C terminal region of human EBF2

Actions biochimiques/physiologiques

EBF2 belongs to the EBF/COE family of transcription factors that contain well-conserved DNA-binding domain. EBF factors play important regulatory roles in various developmental processes and in differentiation of osteoblasts. EBF2 is critical in the generation and migration of Cajal-Retzius neurons during early cortical neurogenesis in cerebral cortex.

Séquence

Synthetic peptide located within the following region: VPRNPSQLPALSSSPAHSGMMGINSYGSQLGVSISESTQGNNQGYIRNTS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Francesca Chiara et al.
Developmental biology, 365(1), 277-289 (2012-03-17)
Cajal-Retzius (CR) cells play a crucial role in the formation of the cerebral cortex, yet the molecules that control their development are largely unknown. Here, we show that Ebf transcription factors are expressed in forebrain signalling centres-the septum, cortical hem
Shu-Mien Chuang et al.
Developmental neuroscience, 33(6), 479-493 (2011-11-02)
Mammalian cortical neurogenesis occurs on a precise time schedule during development. The earliest born neurons form the preplate and later separate into layer 1, which includes Cajal-Retzius (C-R) neurons, and the subplate. The preplate and its derivatives play a critical
Ana Patiño-García et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 15(16), 5082-5091 (2009-08-13)
Osteosarcoma is the most prevalent bone tumor in children and adolescents. At present, the mechanisms of initiation, maintenance, and metastasis are poorly understood. The purpose of this study was to identify relevant molecular targets in the pathogenesis of osteosarcoma. Tumor
S S Wang et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 17(11), 4149-4158 (1997-06-01)
The Olf-1/EBF helix-loop-helix (HLH) transcription factor has been implicated in olfactory gene regulation and in B-cell development. Using homology screening methods, we identified two additional Olf-1/EBF-like cDNAs from a mouse embryonic cDNA library. The Olf-1/EBF-like (O/E) proteins O/E-1, O/E-2, and

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique