AV31477

Anti-SLC30A9 (AB1) antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-Solute carrier family 30 (Zinc transporter), member 9
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 63 kDa
• Espèces réactives: rat, human, horse, guinea pig, rabbit, bovine, dog
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_006336
• Numéro d'accès UniProt: Q6PML9
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SLC30A9(10463)

Description

Description générale

SLC30A9 is a member of the solute carrier family that may function as a zinc transporter.
Rabbit Anti-SLC30A9 (AB1) antibody recognizes rat, human, canine, mouse, pig, bovine, and zebrafish SLC30A9.

The previously assigned protein identifier Q9Y6R2 has been merged into Q6PML9. Full details can be found on the UniProt database.

Immunogène

Synthetic peptide directed towards the N terminal region of human SLC30A9

Application

Rabbit Anti-SLC30A9 (AB1) antibody is suitable for use in western blot assays at a concentration of 0.5-2.0μg/ml. The antibody can also be used for IHC at 4-8μg/ml, using paraffin-embedded tissues.

Actions biochimiques/physiologiques

The gene corresponding to embryonic lung protein [also known as Solute carrier family 30 (Zinc transporter), member 9, SLC30A9], is likely to be an evolutionarily conserved, housekeeping gene that plays a role intimately linked with cellular replication, DNA synthesis and/or transcriptional regulation.

Séquence

Synthetic peptide located within the following region: LKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAINEFCLKSSDLEQLR

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable