Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV100908

Sigma-Aldrich

Anti-CEBPA antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-CCAAT/enhancer binding protein (C/EBP), α

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

38 kDa

Espèces réactives

pig, rat, mouse, bovine, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_004355

Numéro d'accès UniProt

P49715

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CEBPA(1050)

Immunogène

Synthetic peptide directed towards the N terminal region of human CEBPA

Application

Anti-CEBPA antibody produced in rabbit is suitable for western blotting at a concentration of 5 μg/ml.

Actions biochimiques/physiologiques

CCAAT/enhancer binding proteins are involved in the regulation of genes involved in the differentiation of squamous epithelial cells. They have been reported to exhibit altered expression in skin neoplasms. CEB proteins also mediate the functional interaction of IL-6 and TNF-α in mouse embryonic fibroblasts.

Séquence

Synthetic peptide located within the following region: GGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGG

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

En option

Réf. du produit
Description
Tarif

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

H S Oh et al.
The Journal of investigative dermatology, 110(6), 939-945 (1998-06-10)
The epidermis is a stratified squamous epithelium composed primarily of keratinocytes that undergo sequential changes in gene expression during differentiation. CCAAT/enhancer binding proteins (C/EBP) are members of the bZIP family of DNA binding proteins/transcription factors. Northern analysis demonstrated that C/EBPalpha
Matthew J Ruddy et al.
The Journal of biological chemistry, 279(4), 2559-2567 (2003-11-06)
Interleukin (IL)-17 is a recently described cytokine involved in the amplification of inflammatory responses and pathologies. A hallmark feature of IL-17 is its ability to induce expression of other cytokines and chemokines. In addition, IL-17 potently synergizes with tumor necrosis

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique