Skip to Content
Merck
All Photos(2)

Documents

SAB1405227

Sigma-Aldrich

Monoclonal Anti-POLD4 antibody produced in mouse

clone 2C11, purified immunoglobulin, buffered aqueous solution

Synonym(s):

POLDS, p12

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2C11, monoclonal

form

buffered aqueous solution

mol wt

antigen ~29.85 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... POLD4(57804)

General description

Mammalian DNA polymerase (Pol) δ contains four subunits, p125, p50, p68, and p12. DNA polymerase δ 4, accessory subunit (POLD4) is the smallest subunit of DNA polymerase δ. POLD4 gene is located on human chromosome 11q13.2.

Immunogen

POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL

Biochem/physiol Actions

Mammalian DNA polymerase (Pol) δ plays a key role in DNA replication. DNA polymerase δ 4, accessory subunit (POLD4) is involved in cell cycle progression. It helps to maintain the genomic stability of human cells. p12 is essential for the optimal activity of human Pol δ. p12 helps to stabilize Pol holoenzyme. Interaction of p12 with PCNA also aids in stabilizing the Pol-proliferating cell nuclear antigen (PCNA) complex. Lower expression of the POLD4 gene might participate in the progression of lung cancer.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Qin Miao Huang et al.
Biochemical and biophysical research communications, 391(1), 542-546 (2009-11-26)
Mammalian DNA polymerase delta (pol delta) is essential for DNA replication, though the functions of this smallest subunit of POLD4 have been elusive. We investigated pol delta activities in vitro and found that it was less active in the absence
Melanie Haas Kucherlapati
Oncotarget, 10(65), 6913-6933 (2019-12-21)
Genes of the pre-replication, pre-initiation and replisome complexes duplicate the genome from many sites once in a normal cell cycle. This study examines complex components in lung adenocarcinoma (LUAD) closely, correlating changes in the genome and transcriptome with proliferation and
Qin Miao Huang et al.
Cancer research, 70(21), 8407-8416 (2010-09-24)
Genomic instability is an important factor in cancer susceptibility, but a mechanistic understanding of how it arises remains unclear. We examined hypothesized contributions of the replicative DNA polymerase δ (pol δ) subunit POLD4 to the generation of genomic instability in

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service