Skip to Content
Merck
All Photos(3)

Key Documents

SAB1401263

Sigma-Aldrich

Monoclonal Anti-NFIX antibody produced in mouse

clone 3D2, purified immunoglobulin, buffered aqueous solution

Synonym(s):

NF1A

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3D2, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

capture ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NFIX(4784)

General description

Nuclear factor I X (NFIX) is encoded by the gene mapped to human chromosome 19p13.13. The encoded protein is a member of the nuclear factor one (NFI) family of transcription factors.

Immunogen

NFIX (NP_002492.2, 291 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIR

Application

Monoclonal Anti-NFIX antibody produced in mouse has been used in chromatin immunoprecipitation (ChIP) and immunofluorescence (IF).

Biochem/physiol Actions

Nuclear factor I X (NFIX) plays a vital role in normal brain and skeletal development. The encoded protein regulates c-Mpl (thrombopoietin receptor) transcription and promote survival of hematopoietic stem and progenitor cells (HSPCs). Mutation in the gene has been observed in Sotos-like features and Marshall–Smith syndrome patients.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Nfix Promotes Survival of Immature Hematopoietic Cells via Regulation of c-Mpl.
Hall T, et al.
Stem Cells (2018)
Distinct Effects of Allelic NFIX Mutations on Nonsense-Mediated mRNA Decay Engender Either a Sotos-like or a Marshall-Smith Syndrome
Malan V, et al.
American Journal of Human Genetics, 87(2), 189-198 (2010)
Array?CGH detection of a de novo 0.7?Mb deletion in 19p13.13 including CACNA1A associated with mental retardation and epilepsy with infantile spasms
Auvin S, et al.
Epilepsia, 50(11), 2501-2503 (2009)
A novel microdeletion/microduplication syndrome of 19p13. 13.
Dolan M, et al.
Genetics in Medicine : Official Journal of the American College of Medical Genetics, 12(8), 503-503 (2010)
Diana Vidovic et al.
Neural development, 13(1), 2-2 (2018-02-18)
Radial glial stem cells within the developing nervous system generate a variety of post-mitotic cells, including neurons and glial cells, as well as the specialised multi-ciliated cells that line the walls of the ventricular system, the ependymal cells. Ependymal cells

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service