Skip to Content
Merck
All Photos(8)

Key Documents

HPA023310

Sigma-Aldrich

Anti-BAIAP2 antibody produced in rabbit

enhanced validation

affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-BAI-associated protein 2, Anti-BAI1-associated protein 2, Anti-Brain-specific angiogenesis inhibitor 1-associated protein 2, Anti-FLAF3, Anti-IRS-58, Anti-IRSp53, Anti-IRSp53/58, Anti-Insulin receptor substrate p53, Anti-Insulin receptor substrate protein of 53 kDa, Anti-Protein BAP2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

rat, human

enhanced validation

independent
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

WFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNP

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... BAIAP2(10458)

General description

The gene BAIAP2 (BAI1 associated protein 2) is mapped to human chromosome 17q25. The protein has an I-BAR (inverted Bin/amphiphysin/Rvs) domain, a partial Cdc42 (cell division cycle 42)/Rac (v-akt murine thymoma viral oncogene homolog 1) binding domain, Src homology-3 (SH3) domain and a PDZ (PSD95, Dlg1 and zo-1) domain.

Immunogen

Brain-specific angiogenesis inhibitor 1-associated protein 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-BAIAP2 antibody produced in rabbit has been used in:
  • immunofluorescence (1:50) (1:1,000)
  • immunohistochemistry(1:100)
  • western blotting (1:3500) (1:1,000)
  • iimmunostaining

Biochem/physiol Actions

BAIAP2 (BAI1 associated protein 2) interaction with CDC42 (cell division cycle 42) is needed for filopodia formation. It is also involved in neuronal growth cone guidance. Mutations in BAIAP2 are associated with attention-deficit hyperactivity disorder and autism. BAIAP2 also participates in emotional modulation of memory strength. It also regulates cell motility and mediates the coupling of actin- associated remodeling with Rho guanosine triphosphatase (GTPase) and kinase signaling pathways.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST75831

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Lu Liu et al.
Behavioral and brain functions : BBF, 9, 48-48 (2014-01-01)
Attention-deficit/hyperactivity disorder (ADHD) is a common chronic neurodevelopmental disorder with a high heritability. Much evidence of hemisphere asymmetry has been found for ADHD probands from behavioral level, electrophysiological level and brain morphology. One previous research has reported possible association between
David J Kast et al.
Molecular biology of the cell, 30(11), 1285-1297 (2019-03-21)
Filopodia are actin-filled membrane protrusions that play essential roles in cell motility and cell-cell communication and act as precursors of dendritic spines. IRSp53 is an essential regulator of filopodia formation, which couples Rho-GTPase signaling to actin cytoskeleton and membrane remodeling.
Gediminas Luksys et al.
PloS one, 9(1), e83707-e83707 (2014-01-07)
Memory performance is the result of many distinct mental processes, such as memory encoding, forgetting, and modulation of memory strength by emotional arousal. These processes, which are subserved by partly distinct molecular profiles, are not always amenable to direct observation.
Ai Mei Chou et al.
The Journal of biological chemistry, 289(35), 24383-24396 (2014-07-18)
Filopodia are dynamic actin-based structures that play roles in processes such as cell migration, wound healing, and axonal guidance. Cdc42 induces filopodial formation through IRSp53, an Inverse-Bin-Amphiphysins-Rvs (I-BAR) domain protein. Previous work from a number of laboratories has shown that
Sara Bisi et al.
Nature communications, 11(1), 3516-3516 (2020-07-16)
It is unclear whether the establishment of apical-basal cell polarity during the generation of epithelial lumens requires molecules acting at the plasma membrane/actin interface. Here, we show that the I-BAR-containing IRSp53 protein controls lumen formation and the positioning of the

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service