HPA014518
Anti-P2RY12 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-HORK3, Anti-P2Y12, Anti-SP1999
Sign Into View Organizational & Contract Pricing
All Photos(5)
About This Item
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:1000-1:2500
immunogen sequence
KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... P2RY12(64805)
General description
Purinergic receptor P2Y G protein-coupled 12 (P2RY12) is encoded by the gene mapped to human chromosome 3q25.1. The encoded protein belongs to the family of P2 purinergic receptors. P2RY12 is characterized with seven transmembrane G protein coupled receptors (GPCRs) that contributes to ATP-and ADP-mediated cell migration in vitro. The protein is expressed in activated platelets and microglial cells.
Immunogen
purinergic receptor P2Y, G-protein coupled, 12
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-P2RY12 antibody produced in rabbit has been used in immunohistochemistry.
Anti-P2RY12 antibody produced in rabbit has been used in immunohistochemistry.
Biochem/physiol Actions
Purinergic receptor P2Y G protein-coupled 12 (P2RY12) interacts with its ligand ADP and gets activated. This activated receptor plays a vital role in increasing the platelet responses that underlie arterial thrombosis and associated inflammation. P2RY12 is also involved in maintaining thrombus stability in-vivo.Mutation in the gene is associated with the development of ADP receptor deficiency and blood pressure-related disorders. Inhibition of P2RY12 is considered to be a potent therapeutic method for treating pathologic bone loss.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST72771
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Customers Also Viewed
Gloriia Novikova et al.
Nature communications, 12(1), 1610-1610 (2021-03-14)
Genome-wide association studies (GWAS) have identified more than 40 loci associated with Alzheimer's disease (AD), but the causal variants, regulatory elements, genes and pathways remain largely unknown, impeding a mechanistic understanding of AD pathogenesis. Previously, we showed that AD risk
Ghosts in the shell: identification of microglia in the human central nervous system by P2Y12 receptor.
Mildner A.
Neural Regeneration Research, 12(4), 570?571-570?571 (2017)
Ghosts in the shell: identification of microglia in the human central nervous system by P2Y12 receptor.
Alexander Mildner
Neural regeneration research, 12(4), 570-571 (2017-05-30)
Amanda McQuade et al.
Molecular neurodegeneration, 13(1), 67-67 (2018-12-24)
Microglia, the principle immune cells of the brain, play important roles in neuronal development, homeostatic function and neurodegenerative disease. Recent genetic studies have further highlighted the importance of microglia in neurodegeneration with the identification of disease risk polymorphisms in many
Diana G Bohannon et al.
Brain pathology (Zurich, Switzerland), 30(3), 603-613 (2019-12-14)
We previously showed that rhesus macaques neonatally infected with simian immunodeficiency virus (SIV) do not develop SIV encephalitis (SIVE) and maintain low brain viral loads despite having similar plasma viral loads compared to SIV-infected adults. We hypothesize that differences in
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service