Skip to Content
Merck
All Photos(6)

Key Documents

HPA011165

Sigma-Aldrich

Anti-SIRT2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-NAD-dependent deacetylase sirtuin-2, Anti-SIR2-like, Anti-SIR2-like protein 2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41
Pricing and availability is not currently available.

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

KDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLL

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SIRT2(22933)

General description

SIRT2 (sirtuin 2) is a member of a highly conserved protein family called sirtuins. In humans, there are 7 members in this family, from sirtuin1-7. This gene is localized to human chromosome 19q13.2. SIRT2 protein has a helical N-terminal made of 19 amino acids, and a catalytic core made of 304 amino acids. The core region consists of two domains- the larger domain contains a Rossmann fold variant, and the smaller domain contains a zinc atom. This protein resides in the cytoplasm. However, studies show that an alternatively spliced variant of SIRT2, isoform 5, lacks a nuclear export signal and is constitutively localized to the nucleus.

Immunogen

NAD-dependent deacetylase sirtuin-2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

SIRT2 (sirtuin 2) is an NAD+ (nicotinamide adenine dinucleotide)-dependent deacetylase which uses tubulin as its substrate. It is implicated in monitoring mitosis and normal progression of cell cycle. It might be involved in cell cycle checkpoint, and respond to mitotic stress. It prevents chromosomal condensation in response to mitotic stress and thus maintains chromosomal stability. This protein is down-regulated in gliomas, and might act as a tumor suppressor by modulating microtubule network. Studies show that SIRT2 is implicated in the anti-proliferative effects of resveratrol on human glioblastoma stem cells, and therefore, might have potential as a therapeutic target. In neurons with oxidative stress, down-regulation of SIRT2 is responsible for modified microtubule dynamics due to alterations in tubulin deacetylation. Therefore, it might be implicated in Parkinson′s disease. Meta-analysis shows that SNP in this gene is involved in the pathogenesis of Alzheimer′s disease with APOE ε4 status.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71542

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Johannes G M Rack et al.
Journal of molecular biology, 426(8), 1677-1691 (2013-11-02)
Sirtuin-2 (SIRT2), the cytoplasmic member of the sirtuin family, has been implicated in the deacetylation of nuclear proteins. Although the enzyme has been reported to be located to the nucleus during G2/M phase, its spectrum of targets suggests functions in
Yanhua Du et al.
Molecular medicine reports, 15(4), 1638-1646 (2017-03-06)
The silent information regulator 2 related enzyme 2 (SIRT2) has been reported to have an important role in tumorigenesis. Although two distinct effects of SIRT2 have recently been revealed, which explain opposing expression patterns in different types of cancer, the
Wenjin Wei et al.
Neuromolecular medicine, 16(2), 448-456 (2014-02-06)
Previous studies have reported an association between human sirtuins' single-nucleotide polymorphisms (SNPs) and Alzheimer's disease (AD) susceptibility in the apolipoprotein E (APOE) ε4-negative population, although the findings are inconsistent. To obtain a more precise estimation of this relationship, we conducted
P K Bajpe et al.
Oncogene, 34(4), 531-536 (2014-01-29)
Resistance to targeted therapies is a major problem in cancer treatment. The epidermal growth factor receptor (EGFR) antibody drugs are effective in a subset of colorectal cancers, but the molecular mechanisms of resistance are understood poorly. Genes involved in epigenetic
Salwa Sayd et al.
Medecine sciences : M/S, 30(5), 532-536 (2014-06-19)
Sirtuin 2 (SIRT2) is an NAD(+) (nicotinamide adenine dinucleotide)-dependent deacetylase. Studies of this protein have often been divergent, highlighting the dependence of pleiotropic effects of SIRT2 on cellular context. The natural polyphenol resveratrol is known to exert opposite actions on

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service