Skip to Content
Merck
All Photos(1)

Key Documents

HPA036528

Sigma-Aldrich

Anti-WAC antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-BM-016, Anti-FLJ31290, Anti-MGC10753, Anti-PRO1741, Anti-WW domain containing adaptor with coiled-coil, Anti-Wwp4

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

RLSDGCHDRRGDSQPYQALKYSSKSHPSSGDHRHEKMRDAGDPSPPNKMLRRSDSPENKYSDSTGHSKAKNVHTHRVRERDGGTSYSPQENSH

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... WAC(51322)

General description

WAC (WW domain-containing adaptor protein) is present on human chromosome 10p12.1. It has a coiled coil domain and exists in four isoforms.

Immunogen

WW domain containing adaptor with coiled-coil recombinant protein epitope signature tag (PrEST)

Application

Anti-WAC antibody produced in rabbit can be used for the detection of WAC protein in human embryonic kidney cells 293 lysate by immunoblotting. It may also be used for the detection of WAC proteins in HeLa cells by immunoblotting.

Biochem/physiol Actions

WW domain-containing protein associates with Golgi matrix protein 120 and regulates generation of autophagosomes. During amino acid starvation, WAC also interacts with Golgi protein short coiled-coil protein (SCOC) to mediate autophagy. The coiled coil domain of WAC interacts with ubiquitin-protein ligase complex and aids in ubiquitination of histone H2B, favoring gene expression. WAC assists in the activation and entry of polo-like kinase into mitotic cycle. Microdeletions and de novo mutation in the WAC genome locus is associated with behavior disorders, developmental delay and facial abnormalities in children. Nonsense and frameshift mutations in the WAC gene results in a truncated protein product leading to hypotonia, interrupted development and dysmorphic facial features.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST80181

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A de novo 10p11. 23-p12. 1 deletion recapitulates the phenotype observed in WAC mutations and strengthens the role of WAC in intellectual disability and behavior disorders
Abdelhedi F, et al.
American Journal of Medical Genetics. Part A, 170(7), 1912-1917 (2016)
Deletion at chromosome 10p11. 23-p12. 1 defines characteristic phenotypes with marked midface retrusion
Okamoto N, et al.
Journal of Human Genetics, 57(3), 191-191 (2012)
WAC, a novel WW domain-containing adapter with a coiled-coil region, is colocalized with splicing factor SC35
Xu GM and Arnaout MA
Genomics, 79(1), 87-94 (2002)
Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC
McKnight NC, et al.
The Embo Journal, 31(8), 1931-1946 (2012)
Activation of ULK kinase and autophagy by GABARAP trafficking from the centrosome is regulated by WAC and GM130
Joachim J, et al.
Molecular Cell, 60(6), 899-913 (2015)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service