Skip to Content
Merck
All Photos(1)

Key Documents

SAB2104114

Sigma-Aldrich

Anti-NRARP antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-MGC61598

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

12 kDa

species reactivity

mouse, rat, dog, bovine, pig, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... NRARP(441478)

General description

NRARP (NOTCH-regulated ankyrin repeat protein) works as a negative feedback regulator in Notch (neurogenic locus notch homolog protein) signaling. On the other hand, expression of NRARP is controlled by Notch protein. The protein has two ankyrin repeats.

Immunogen

Synthetic peptide directed towards the middle region of human NRARP

Biochem/physiol Actions

During development, NRARP (NOTCH-regulated ankyrin repeat protein) is involved in crosstalk between NOTCH (neurogenic locus notch homolog protein) and WNT (wingless-type mouse mammary tumor virus integration site) signaling. Presence of NRARP allows proper vessel density in angiogenesis. In breast cancer, NRARP might enhances the cell proliferation. It is upregulated in thyroid cancer tissues and is associated with cell growth and invasion. It is also overexpressed in hepatocellular carcinoma tumor tissues.

Sequence

Synthetic peptide located within the following region: QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Overexpression of NOTCH-regulated ankyrin repeat protein is associated with breast cancer cell proliferation.
Imaoka T, et al.
Anticancer Research, 34, 2165-2171 (2014)
Nrarp coordinates endothelial Notch and Wnt signaling to control vessel density in angiogenesis.
Phng LK, et al.
Developmental Cell, 16, 70-82 (2009)
Downregulation of Notch-regulated Ankyrin Repeat Protein Exerts Antitumor Activities against Growth of Thyroid Cancer.
Chu BF, et al.
Chinese Medical Journal (English Edition), 129, 1544-1552 (2016)
Pingping Zhu et al.
Nature communications, 6, 7122-7122 (2015-05-20)
Liver cancer stem cells (CSCs) harbour self-renewal and differentiation properties, accounting for chemotherapy resistance and recurrence. However, the molecular mechanisms to sustain liver CSCs remain largely unknown. In this study, based on analysis of several hepatocellular carcinoma (HCC) transcriptome datasets

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service